KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_1359Help
Entry
Zymop_1359        CDS       T01556                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Pathway
zmp00040  Pentose and glucuronate interconversions
zmp00052  Galactose metabolism
zmp00500  Starch and sucrose metabolism
zmp00520  Amino sugar and nucleotide sugar metabolism
zmp01100  Metabolic pathways
zmp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:zmp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Zymop_1359
   00052 Galactose metabolism
    Zymop_1359
   00500 Starch and sucrose metabolism
    Zymop_1359
   00520 Amino sugar and nucleotide sugar metabolism
    Zymop_1359
Enzymes [BR:zmp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Zymop_1359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AEI38249
UniProt: F8EV31
Position
complement(1587549..1588418)
Genome map
AA seq 289 aa AA seqDB search
MKPVRKAIFPVAGQGTRFLPATKAMPKEMLPVVDRPLIQYAVDEARAAGIEELIFVTGRG
KQAIEDYFDIAYELEASLHAKGKIAMLDLLADSRLEPGRACFIRQQEPLGLGHAVWCARD
LIGNEPFAVLLPDELLWNPKQPSLCQLVETYNIKGGNVVTVMEVPEAHTHRYGIIDPDKT
EGDVHEVKGLVEKPETNAPSRLAMVGRYILQPEIMDLLAEDNRGVGGEIQLTDAMAQLIG
QYPFHACRFDGIRHDCGDKAGFIQANVALALERPDIGPAVREYLKHQSF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctgttcgtaaggctattttccctgtcgcaggccaagggacccgttttctacct
gcgactaaagccatgccgaaagaaatgttgccagtcgttgaccgtcctcttatccaatat
gctgttgatgaagcgcgggcggctgggatcgaagagctaatctttgttacggggcgtggc
aaacaggccatcgaagattatttcgatatagcctatgaattagaggcctctcttcatgcc
aaaggtaaaatagcgatgctggatctgctcgctgatagccgattggaacccggacgcgct
tgttttattcgccagcaagaacctttgggtttaggccatgccgtgtggtgtgccagagac
ttgattggaaatgaaccctttgccgttctgttgccggatgaattattgtggaatcctaaa
caacccagtctatgccaactcgttgaaacctataatatcaaaggcggtaatgttgtaacc
gttatggaagtgccagaagcgcatacccatcgctatggtattattgatcccgataaaact
gagggtgatgtgcatgaagtgaaaggtctagttgaaaagccagaaactaatgctccatcc
cgtttagcgatggtcggtcgttatattctccaaccggaaattatggatttgttggcagaa
gataatcgcggtgttggtggtgaaatacagttaacagatgctatggcacaattgattggg
cagtatccttttcatgcctgtcgatttgatggtattcggcatgattgtggggacaaggca
ggatttattcaggcaaatgttgctttagcgctcgaaaggcctgatataggccccgcggtc
agagaatatctgaagcatcagagtttctaa

DBGET integrated database retrieval system