KEGG   Zymomonas mobilis subsp. mobilis NRRL B-12526: A254_00834Help
Entry
A254_00834        CDS       T03160                                 

Gene name
arg
Definition
(GenBank) Arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
zmr  Zymomonas mobilis subsp. mobilis NRRL B-12526
Pathway
zmr00220  Arginine biosynthesis
zmr00330  Arginine and proline metabolism
zmr01100  Metabolic pathways
zmr01110  Biosynthesis of secondary metabolites
zmr01130  Biosynthesis of antibiotics
zmr01230  Biosynthesis of amino acids
Module
zmr_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:zmr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    A254_00834 (arg)
   00330 Arginine and proline metabolism
    A254_00834 (arg)
Enzymes [BR:zmr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     A254_00834 (arg)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AHJ70453
UniProt: A0A2R9NV31
Position
938740..939612
Genome map
AA seq 290 aa AA seqDB search
MSSINKPLRLIFPQWQGGDNPPYYLGSQLLAWLSPDPKGAVEEVPVPKPTGEPLQEENGI
VGRSILIDQLSKARQLIEKHTPDSLVVLGGDCLVSLAPFSWLLEKYKDKLGILWIDSHPD
VQTPKEYKNAHAHVLGELMGNGDSDFTRTVKHPVSPQKIMIAGIHDPLPYEANFISEHKI
QTCSPEQVRSGAQPVLDWIKNEKIEYLAIHIDLDVLDPHNFRSVLFAKPGRGQHDFGDVA
EGKLNIPDVVKLANQAASISKAVGLTIAEHLPWDALNLKNMLEELPLIGK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtattaataaaccgttgagactcattttcccgcaatggcaaggtggtgataat
cccccttactatttgggttcgcagcttttggcgtggttatcgcctgatcccaaaggtgcg
gttgaagaagttcctgttccaaaaccaacaggagaaccgctgcaagaagaaaatggcatt
gttgggcggtcaattttaatagatcagctatcaaaagcgcggcagttaatcgaaaagcac
acaccggattctctagttgtcttaggcggtgattgccttgtttctttagcacccttctca
tggcttcttgaaaaatataaagataagttagggattctttggatcgattcacatccagat
gttcaaacgcccaaggaatataaaaatgcgcatgcccatgtgcttggggaattgatgggt
aatggcgattctgattttaccagaacggttaaacacccagtatctccacaaaaaattatg
attgcgggcatacatgacccgctcccctatgaagcaaattttatttccgagcataaaatt
caaacttgctctccagaacaggtaaggtctggcgctcaacccgttttagactggatcaag
aatgaaaaaatcgaatatctggccatccatatagacttggatgttttggatccccataat
ttcagatctgttctttttgctaaaccgggtcgaggacagcatgatttcggggatgtcgca
gaaggcaaattaaacataccagatgtcgtaaaattggctaatcaagcggcctctatttcc
aaggcggtgggtttaactattgccgaacatctcccatgggatgcgcttaatttaaagaat
atgctcgaagagctgcctttaatcgggaaataa

DBGET integrated database retrieval system