KEGG   Zymomonas mobilis subsp. mobilis NRRL B-12526: A254_00855Help
Entry
A254_00855        CDS       T03160                                 

Gene name
argF
Definition
(GenBank) Ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
zmr  Zymomonas mobilis subsp. mobilis NRRL B-12526
Pathway
zmr00220  Arginine biosynthesis
zmr01100  Metabolic pathways
zmr01110  Biosynthesis of secondary metabolites
zmr01130  Biosynthesis of antibiotics
zmr01230  Biosynthesis of amino acids
Module
zmr_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:zmr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    A254_00855 (argF)
Enzymes [BR:zmr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     A254_00855 (argF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N OCD_Mu_crystall ATPgrasp_N
Motif
Other DBs
NCBI-ProteinID: AHJ70474
UniProt: A0A2R9NV57
Position
complement(958465..959406)
Genome map
AA seq 313 aa AA seqDB search
MPHSIKRRHFLNFADAGADAVKAMLADALARKQARKGWPKGRVDADAPLKDSILGMIFEK
NSTRTRVSFDVGMRQLGGSTIVMESGSTQIGRGETIADTARVLSRFIDAIMIRTDDHAKI
EELARYASVPIINGLTDLSHPCQIMADMLTVIEHKGKVEGTRWAWLGDGNNVLYSIIEAS
GLMGFSVIAACPHGYEPDPKFIEAARKAGCDVVITDDPDEAVKGADVVVTDTWISMGQAH
AEAKMAAMQPYQVNEALMAKAGDQALFLHCLPAHRGEEVVDAVIDGSRSVVWDEAENRLH
AQKSVLLWSLGLL
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtgccccattcaataaaacgtcgtcattttctgaattttgctgatgctggtgcagatgct
gtgaaagctatgctcgcggatgctttggcgcgtaaacaggcgcgaaaaggctggccaaaa
ggacgggttgatgccgatgcgccgttaaaagattctattctcgggatgatttttgagaaa
aattcaacccggacaagagtgtcttttgatgtcggaatgcgacagcttgggggcagcacc
atcgttatggaatccggatcgacccaaatcggtcgcggtgaaaccattgccgatacggct
cgtgtattatcccgctttattgatgcgatcatgatccgcaccgatgaccatgcgaaaatc
gaagaactggcgcgttatgcttcggttcctattatcaatggtttgacggatttatcccat
ccttgccagattatggcggatatgctgacggtgatagagcataagggtaaagtggagggc
acacgttgggcttggctgggtgatggtaacaatgtgttatattccatcatcgaagccagt
ggccttatgggcttttctgttatcgcggcttgccctcatggttatgaacctgatccgaaa
tttatcgaagcggcgcgtaaagcaggctgcgatgtggttattaccgatgatcccgatgaa
gctgtcaaaggcgcggatgtcgtcgtaaccgatacatggatttccatggggcaggcgcat
gctgaagcaaaaatggccgctatgcagccttatcaggttaatgaagccttgatggcaaag
gctggcgatcaggctttattcctgcattgcttgcccgcccatcgaggtgaagaggtcgtc
gatgctgttattgacggttctcgttctgtggtttgggatgaggctgaaaatcggctccat
gcccagaagtcggttctgctttggtcattaggattattataa

DBGET integrated database retrieval system