KEGG   Zymomonas mobilis subsp. mobilis NRRL B-12526: A254_01252Help
Entry
A254_01252        CDS       T03160                                 

Definition
(GenBank) putative pyridoxal phosphate-dependent acyltransferase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
zmr  Zymomonas mobilis subsp. mobilis NRRL B-12526
Pathway
zmr00780  Biotin metabolism
zmr01100  Metabolic pathways
Module
zmr_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:zmr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    A254_01252
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:zmr01007]
    A254_01252
Enzymes [BR:zmr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     A254_01252
Amino acid related enzymes [BR:zmr01007]
 Aminotransferase (transaminase)
  Class II
   A254_01252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Beta_elim_lyase SHMT Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AHJ70863
UniProt: A0A2R9NWB2
Position
1430962..1432071
Genome map
AA seq 369 aa AA seqDB search
MISALSDNQLLCDFSSNDYLGLSSHPLLKERSQLWTDQFGVGSRASRLVSGTLPIHLEVE
KKVALLKGKEAALLFPSGWQANASVLPALFRLSLEQTGHKALVFTDKLNHASIHLGCSAA
GIKQIRFRHNDLPHLEQLLEKQKQVDGLRFIITESVFSMDGDQAEIGTLRQIADKYNAFL
YVDEAHATGVLGENGQGLAGGANGADLVMGTFSKALGCFGAYIAGSTLLCDWLVNSCSGF
IYSTAMPPSMIGAMDAALDILPTLSKERKQLIERSNHIRKEFQSMGLDTGLSSTHIIPVM
IGNNEATLLAAQRLKDEGILAIAIRPPTVPLHAGRLRFAITSLHNDAMLEHLSHVMKKLA
AEIHRGSSI
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgattagcgctctttctgataatcagcttttatgcgacttttcttctaatgattacctt
ggtctttcttcccatcctctcctaaaagaacgatcccagttatggacagatcaattcggg
gttggctctcgggcttcgcgtctggtttctggaacactaccgatacatcttgaagtcgaa
aaaaaagtggctcttttaaaaggcaaggaagcggctttactctttccatctggctggcaa
gctaatgcttcagttttacccgccttatttcgactctcgcttgaacaaactggtcataag
gctcttgtttttacggataagctaaatcatgcaagtatacatcttggatgctccgctgcc
ggtatcaagcaaatccgatttcgtcataatgatttgcctcatttagaacagcttctagaa
aaacaaaaacaggtagatggactccgctttattataaccgaaagcgtttttagtatggat
ggcgatcaggcagagatcggaacgcttcgtcaaatcgctgataaatataatgcctttctc
tatgtggatgaagcccatgcaacaggtgttctcggagaaaatggccaagggcttgctgga
ggcgctaacggggctgatttggttatgggaacatttagtaaggcgttaggctgctttgga
gcttatattgcaggatccacgttgctttgtgattggcttgtgaatagctgttctggattt
atctatagcacagctatgccgccatcaatgattggggcaatggacgctgctttggatatt
cttccgactttgtcaaaagaacgcaaacaacttattgaaagatcgaatcatatccgaaaa
gaattccaatctatggggttagatactggcttatcttctacccatattattcctgttatg
atcggtaataatgaagccaccttgttggctgcgcaaagattaaaagatgagggtattctc
gctattgcaatccggcctcccactgtgccgcttcatgctggacgtcttcgctttgctata
acctctcttcataacgatgccatgctagaacatctgagtcatgttatgaaaaaattagcg
gctgaaatacacagaggatcttcgatatga

DBGET integrated database retrieval system