KEGG   Zootermopsis nevadensis: 110827725Help
Entry
110827725         CDS       T05136                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial isoform X1
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
zne  Zootermopsis nevadensis
Pathway
zne00970  Aminoacyl-tRNA biosynthesis
zne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zne00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    110827725
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:zne03029]
    110827725
Enzymes [BR:zne01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     110827725
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     110827725
Mitochondrial biogenesis [BR:zne03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    110827725
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-GeneID: 110827725
NCBI-ProteinID: XP_021915331
Position
Unknown
AA seq 566 aa AA seqDB search
MTVIYNGRKYAFAFAITTLFTRRCSFCTTNVSTDSGNFILRKVKPSSSQIARYTNEAIFK
NKTRSHWKAVVGLEVHAQITSTSKLFSGAGTEFGAPVNTNVSLFDAAIPGTLPVLNRRCV
EAGVLTALALSCRVNPVSVFDRKHYFYADLPAGYQITQHRLPLAQEGELEFHVFIPDVHH
KPYIKKSCIKQLQLEQDSGKLLHDEEACRSLVDLSRAGIPLMELVFEPDLEDGEEAAALV
KELILILQCLGTCSCKMEEGALRVDANVSVHREGEPLGVRSEVKNIGSIRAVAHAVKYEI
DRQVRTLESGGVVVNETRAWDTDSRQTVPMRDKEEKQDYRYMPEPNLPPLRVLLNGQHAI
PDIKKDCVNVDCLRRKLPELPRETREKLINQYGISAESAVILVNENNLLKHFYGIMGEKK
SRDPKLSTNILIMELLTILNKNKLSLETSPFSSYSLGEVVDLLQSKKVNLVTARKLLQEI
VSGNPQSPSEMVEKYGWAQITDSSEIEDVCTAVIEQNPRLVEQFCAGKTKVFNSLVGKVA
KITENRANMALVVKVLRDKLSKIQNS
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgactgtaatttataacggaaggaaatatgcatttgcctttgcgattaccacactattc
actcgtaggtgtagcttctgtaccactaatgtaagcactgactcaggaaactttatttta
cgcaaggttaagccttccagttctcaaattgctagatatacaaacgaagcaatatttaag
aataaaacgcggtcacattggaaggccgttgttggactagaagttcatgctcagattaca
tcaacatccaaactgttttctggagctgggacagagtttggtgccccagtgaatacaaat
gtatcactatttgatgctgccatccctggcactcttcctgtgctgaatagaagatgtgtt
gaggctggagtattaacagctttagctctttcatgcagagtgaatcctgtttctgtcttt
gaccgaaaacattatttctacgctgatcttcctgctggctatcaaatcacacagcacaga
cttccactggcacaagaaggagaattagagtttcatgtttttattcctgatgtccatcat
aagccatatattaagaaatcttgcatcaagcagcttcaattagaacaggacagtggcaag
ttacttcatgatgaagaggcttgtaggagcctggttgatttgagccgtgcaggaatacct
cttatggagcttgtatttgaacctgatcttgaggatggagaagaggcagcagctttggtt
aaagaactgatactcattctgcagtgtttaggtacatgttcgtgtaaaatggaagagggt
gctttaagagtggatgcaaatgtctcagttcatcgtgaaggagaaccactaggtgtgcgg
agtgaggtgaagaatattggaagtataagggcagtagcacatgctgtcaagtatgaaatt
gaccgccaagttaggacacttgaatcaggaggagttgttgttaatgaaactcgtgcatgg
gatactgacagtcggcagactgttcctatgcgagacaaggaagagaaacaggactaccgc
tacatgccagaaccaaatcttcctccattacgagttctgttgaatggccaacatgcaata
ccagacattaagaaggattgtgtaaatgttgattgcttgagaagaaaattgccagaattg
cctagagaaaccagggagaagctaataaaccaatatggaatatcagcagaatctgcagtc
atattagttaatgaaaacaatttgttgaaacatttttatggtataatgggggaaaagaag
agtcgtgacccaaaactgtcaacaaatattctaatcatggaactccttactatattaaat
aagaataagttatcactggaaactagtccattttcatcttattccctaggagaagtagtg
gatcttctacagagtaagaaagtaaatctggttactgcacggaagttacttcaggaaatt
gtttctggcaatcctcagtctccatcagagatggtggaaaagtatggatgggctcaaatc
actgattcaagtgaaattgaggatgtttgtacagcggtgatagaacaaaatccaaggctg
gtggaacagttttgtgctggaaaaactaaagtatttaattctcttgttggaaaagttgcc
aagataacagagaacagggcaaacatggcacttgtagttaaagttctgagagacaaatta
agcaaaatacagaattcttaa

DBGET integrated database retrieval system