KEGG   Zootermopsis nevadensis: 110828244Help
Entry
110828244         CDS       T05136                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 1-like
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
zne  Zootermopsis nevadensis
Pathway
zne03410  Base excision repair
zne04214  Apoptosis - fly
Brite
KEGG Orthology (KO) [BR:zne00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    110828244
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    110828244
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:zne03032]
    110828244
   03036 Chromosome and associated proteins [BR:zne03036]
    110828244
   03400 DNA repair and recombination proteins [BR:zne03400]
    110828244
Enzymes [BR:zne01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     110828244
DNA replication proteins [BR:zne03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     110828244
Chromosome and associated proteins [BR:zne03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    110828244
DNA repair and recombination proteins [BR:zne03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     110828244
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PARP_reg WGR
Motif
Other DBs
NCBI-GeneID: 110828244
NCBI-ProteinID: XP_021916477
Position
Unknown
AA seq 372 aa AA seqDB search
MNLTLKLFTLVSFLRLLLKCLLCCRYWLFRSWGRIGTTIGGKKLEEVQTLKNALQIFESM
YEEKTGNMWFDRNNFQKVPGRFYPVDLDYTQEDDETLLQAGSSSITCKLLPPMQELVQLV
FDVNLMEHVVLEFELDLQKMPLGKLSKKQIQQAYSVLTDMQELIKNGGSDSRFIDASNRF
YTLIPHDFGVENPPVLKSEEMIKQKTEMLDSLMEVESAYKLQKGDADGNVHPLGAHYAKL
NTDIXVLDKNTDEFELLKQYVKNTHATTHTHYDLEILEVFKLKRSGEEKRYKPFKKLHNR
KLLWHGSRLTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCCTSPNNSVG
LLLLCEVALGNM
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaacctaactttgaagttattcacgttggtgtctttcttgcggttgctattgaaatgc
ttattgtgttgcaggtattggttattccggtcatggggccgcataggcaccacaatcgga
ggcaagaagttagaggaagttcaaaccttgaaaaatgcacttcaaatctttgagagcatg
tacgaggaaaagacgggaaacatgtggttcgatagaaacaattttcagaaagttcctgga
cgtttctaccctgtcgacttagactatactcaggaagatgatgaaaccttactgcaggca
ggaagttccagtatcacatgtaaacttttgccacctatgcaagagttggtacaactggta
tttgatgtgaatttgatggaacatgttgtgctggaatttgagttggacttacagaagatg
cctctggggaaattaagcaagaagcagatccagcaagcatatagtgtcttgacagacatg
caagaattaatcaagaatggtggatctgatagccgtttcattgatgcctcaaaccgattt
tacactctcatcccacatgattttggtgtagaaaatccaccagtactaaagtctgaggaa
atgattaagcaaaagacagagatgttggacagcctcatggaagtagagagtgcatacaag
ttgcagaaaggtgatgctgatggtaatgtgcaccctctgggtgctcattatgctaagctc
aataccgacatctaggtactggacaaaaacactgatgagtttgagctgctgaaacagtat
gttaagaacactcacgcaacaacacacactcattatgacctggagattttggaggtgttc
aagcttaagcgcagtggagaagaaaaaaggtacaaacctttcaaaaagttacacaaccgg
aagctgctgtggcatggatctcgtctaactaactttgcaggcattttgtctcagggtttg
cgaattgctccaccagaagcaccagttacaggttatatgtttggtaaggggatctacttt
gcagacatggtgtccaagtctgccaactactgctgcacttctccaaacaattcagttggg
ttgcttctcctgtgtgaagttgctttaggaaatatgtaa

DBGET integrated database retrieval system