KEGG   Zootermopsis nevadensis: 110829104Help
Entry
110829104         CDS       T05136                                 

Definition
(RefSeq) mitochondrial enolase superfamily member 1-like isoform X1
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
zne  Zootermopsis nevadensis
Pathway
zne00051  Fructose and mannose metabolism
zne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    110829104
Enzymes [BR:zne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     110829104
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C DUF3788 DUF3025
Motif
Other DBs
NCBI-GeneID: 110829104
NCBI-ProteinID: XP_021918173
Position
Unknown
AA seq 463 aa AA seqDB search
MFGNTMYRDTGLKIRTLHVRDIRFPTSLGSHGSDAMHVDCNYSCTYVIIYTEGDVEGHGL
TFTIGHGNEIVVAAVKSLSPLVVGQDADQIFNDFACFWRKLTSDSQLRWIGPEKGVIHLA
TAAIINALWDLWANLQQKPLWKLLVDMEPEKLVSTIDFRYISDVVTKEEAVAMLKAMETG
KEEREEQMKRVGYPAYTTQAGWLGYSNEHVKTLCSQYLANGFTAFKVKVGQNLEDDRRRC
TMVRKIIGWDNKLMVDANQVWDIEQAIEWMKQLAEFKPLWIEEPTSPDDILGHATISKAL
KPLGIGVATGEMCCNRVMFKQFLQARAMQYCQIDSCRIGGVNEVLSVYFMAKKLGVPVCP
HAGGVGLCEMVQHLQIFDYICLTGTTEGRMIEYTNQQHEHFENPIKVIHAHYIAPKMPGY
STVMKPDSVEAYEYPHGSKWQEMFAKGLFPDPTKQNVFVCPAK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgttcgggaatactatgtatcgagatacaggactcaaaatcagaacactccatgtacgg
gacatccgctttcccacatcactagggtcacatggatcagatgcaatgcatgtggactgc
aactattcctgcacatatgtcattatctatacagaaggagatgtggagggccatggcttg
actttcaccattggtcatgggaatgaaatagttgttgctgctgttaaatcactgtcacca
cttgtagttggtcaagatgcagaccaaattttcaatgacttcgcttgcttctggaggaaa
cttaccagtgattcacagttgcgatggataggtcctgagaaaggggtcattcatttggcc
acagcagctattataaatgccctgtgggatctgtgggccaatttgcaacaaaaaccttta
tggaagctcttggtggacatggaacctgagaaattagtttccacaattgacttcagatat
atttcagatgtggtaacaaaagaggaagctgttgcaatgttaaaggcaatggagactggc
aaagaagaacgggaggaacagatgaaaagagttggatatccagcctatacaacacaagct
ggatggctgggttactcaaatgagcatgtgaaaactttgtgttctcaatatcttgccaat
ggctttacagcctttaaagtgaaggtaggtcaaaatctggaagatgatcgtcgtcgatgt
acaatggtgcgaaaaatcattggctgggacaataaactgatggtagatgcaaaccaggtg
tgggacatcgaacaagccattgaatggatgaagcagttggcagaatttaagccattatgg
atagaagagccaacctctcctgatgatattttgggacatgctactatctctaaggcattg
aagccactaggaattggagtggccacaggagagatgtgctgcaatcgtgtcatgtttaag
cagttccttcaagcaagagcaatgcagtattgccaaattgactcatgtcgtataggcggg
gtcaatgaggttctctcagtttacttcatggccaaaaaacttggagtgcccgtgtgtccc
catgcaggtggtgtgggtctatgtgaaatggtacaacacctccaaatatttgactacatt
tgcctgactggcacaacagagggccgaatgattgagtacacaaaccagcaacatgaacat
tttgagaacccaataaaggtcatacatgctcactacattgcacctaagatgcctggttac
agcacagtgatgaaacctgactctgttgaggcttatgaatatccacatggaagtaaatgg
caagaaatgtttgccaaaggattatttcctgatccaactaagcaaaatgtatttgtatgc
ccagccaaataa

DBGET integrated database retrieval system