KEGG   Zootermopsis nevadensis: 110830039Help
Entry
110830039         CDS       T05136                                 

Definition
(RefSeq) GPI transamidase component PIG-T
  KO
K05292  GPI-anchor transamidase subunit T
Organism
zne  Zootermopsis nevadensis
Pathway
zne00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
zne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zne00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    110830039
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 110830039
NCBI-ProteinID: XP_021920106
Position
Unknown
AA seq 575 aa AA seqDB search
MRGALYASVFISFIHLFFSVTCVPQNDYFDEELLLKPLPSGHVFAYFQFTTIWDLESEAT
FYQHYHLFPRALGEIVGWYNVQELHISLTAGLWRYEHWGYPVHDAAPGAEMWAWFKEDTK
NVDTTWRELAGALSGLLCASLNSIDASNSLNPEFTFQLPGRVSSRAVNSSYLRYATLPRE
IVCTENLTPWKKLLPCDAKKGLSTLLNAGHIYNTNYHSLGIHLRPVCRDSNCSQISVELR
QTLSLVYDMVILGIGNQDFSIKKLFGIGLSGACPLATMSNIYIDTTLNETGASFKLSPPP
PAVIASSRGGYESKFAVYDVKALGIDGMFNIAAFYSSPRVHGVNLPPVLYANRYIIGYGQ
EYGGIVTKVYNGLWKPLDVVYLENIPWFIPLYLHTLKIVANGKEIKPLLKRYIPGKARTR
PYYLEVALRLPARSTTEIYIEFDYVFLKWQEYPPDANHGFYIGAAIITALLPVGRNYTGL
PQDGSTISSSFNASRDGYLVQIRTETLIITMPTPDFSMPYNVICLACTVVALAFGPLHNM
TTKRLRLKDEGGQNHLISLLKSAFKRSSEKKEKRS
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgaggggtgcattatatgcatctgtttttatctcgtttatacatttgtttttttccgtt
acatgtgtacctcagaatgattattttgatgaagaattgttgttaaaacccttgcccagt
ggtcatgtgtttgcgtattttcagtttacaacaatatgggatcttgaatctgaagccact
ttctatcaacattatcatctcttcccacgggctcttggagaaattgtaggttggtacaat
gttcaagaacttcacatcagtctcactgcagggctttggaggtatgaacactggggctat
cctgtgcatgatgcagcacctggagcagaaatgtgggcctggtttaaagaagacaccaaa
aacgttgatacaacgtggagagaactggcaggtgctctgtcaggattgctttgtgcttcc
ttgaattccattgatgcatcaaacagtttgaatcctgagttcactttccagctacctgga
cgtgtatccagtagagctgtaaattcatcatacttgcgttatgcaactcttccaagagaa
attgtctgtactgaaaatttgacaccatggaagaagcttcttccttgtgatgctaagaaa
ggcctgtcaacattgctgaatgctggtcatatttacaacaccaattaccattctctgggt
attcatttacgaccagtgtgcagggactctaactgttctcagatatcagttgagttacgg
cagacactgtccctggtatatgatatggtgatactgggaataggaaatcaggatttttcc
ataaagaaactttttggaattggtttgagtggtgcttgccctcttgctacgatgagcaat
atttacattgacactactttgaatgagacaggagcttcttttaagctgagtccacctcca
cctgcagtaattgccagtagtcgtggtggctatgaaagcaagtttgctgtttatgatgta
aaagcactgggcattgatggcatgttcaatattgcagcattttacagttccccaagagtt
catggagttaatcttccaccagtattgtatgctaacagatacattattggctatggccaa
gaatatggaggaattgttactaaagtatacaatggactttggaaaccactggatgttgta
tatttggaaaatattccatggtttatacctctgtaccttcataccctcaagattgtagca
aatggaaaggaaatcaaaccattgttgaagaggtacatacctggaaaagcacggactcga
ccatactatcttgaggttgctttgagacttccagctagatccacaactgagatttatatt
gagtttgattatgttttcctgaagtggcaagagtatcctccagatgctaatcatggcttc
tacattggtgcagctataatcacagccctcctgccagttgggagaaactacacaggattg
ccacaagatggcagcactatatcatcgagttttaatgcatctagagatggctacttggta
cagatcaggactgaaacactgattattactatgcctacaccagacttcagcatgccgtac
aatgtcatttgcttagcctgtactgtggttgctctggcatttgggccgcttcacaacatg
accactaaaaggttacgactgaaagatgaaggaggacagaatcaccttattagtttgtta
aaatctgcatttaaaagatcatctgaaaagaaagaaaaacgaagttga

DBGET integrated database retrieval system