KEGG   Zootermopsis nevadensis: 110830261Help
Entry
110830261         CDS       T05136                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
zne  Zootermopsis nevadensis
Pathway
zne00010  Glycolysis / Gluconeogenesis
zne00562  Inositol phosphate metabolism
zne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110830261
   00562 Inositol phosphate metabolism
    110830261
Enzymes [BR:zne01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     110830261
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     110830261
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 110830261
NCBI-ProteinID: XP_021920642
Position
Unknown
AA seq 442 aa AA seqDB search
MSTRRMLLSILLATILVSLVAGHYDTCLAENKNPYVMFSTYTPYELVHENSDDPVSIPKC
KPIQFWILSRHGTRYTDVDGINDMWSLIDFRDQIINNYKNGWGALCAEDVDNLKKWTPQA
VSTVSMNLTPQGYKDAYNLALRYKSKFPSLLNQSYDPDKFEVKFTESQRTTLTAFAFIDG
IFGSTVDVQLPQPISPDPLLKPSDYCTAWINEVHDNPDIKKEYNAFKKGPEIEEVTRIVS
KRLGFGSSIGFDNLDLIYTICRFEKAWNVYNISPWCAAFSEDDLKVLEYKEDLDSYYKRG
FGTEMNKLVGCPLAKDFIDRFRKLENWEKQPAGVFYFSHDTDMQLFFTSLGIGEDERPLT
HSNYASMGNRNWRTSLLTPFASNFVAIFFKCDEGEPFRVQFHLQEKLLKLKGCKDDKWGL
CDWSVFKQNYGSISKTCNLDFC
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgagtactcgcagaatgctgctatctattttgttggccaccatattggtctctctggtg
gccggtcactatgatacgtgtttagccgaaaataaaaatccgtatgtgatgttctccacg
tacactccgtatgaacttgtgcatgagaattcggatgatccagtcagcattcctaaatgc
aagccgatacaattctggattttatctcgccatggaacaagatacacagatgtagatggc
attaatgacatgtggtcacttattgatttccgagatcaaataatcaataattataaaaat
ggatggggggcattatgtgctgaggatgtggacaatctcaagaagtggacgccacaagcc
gtctcaaccgtgtcaatgaatttgactcctcagggctataaagatgcctataatttagca
ctacgctacaagtctaagttcccatcgttattgaatcagtcgtacgatcctgacaagttt
gaggtcaaatttaccgaatcgcagcgaactacacttactgcatttgcatttattgatggg
atatttggcagcactgttgatgtacagttacctcagcctatatctcctgatccacttctt
aagccgtcggactactgcactgcgtggatcaatgaagtgcatgacaatccggacataaaa
aaggagtacaatgcattcaagaagggccctgagatagaagaagtcacacgaattgtctct
aagaggttaggattcggaagctcaattggttttgataatctggacctgatttacactatt
tgtcgatttgaaaaggcatggaatgtttataatatctcgccatggtgcgctgccttctcc
gaggatgacttgaaggttttggagtacaaagaagacttggactcttactacaaacgcggt
tttggcaccgaaatgaacaagctagttggttgccctctagcaaaagatttcattgatcgt
ttcagaaaactggagaattgggaaaaacagcctgccggagtcttttacttcagtcacgac
acagatatgcagttgtttttcacctctcttggcatcggagaggatgaaagacccctcact
cactcaaactatgcatcaatgggaaatagaaattggagaacatccctgttgacgcccttt
gcgagcaactttgtggccattttctttaaatgcgacgaaggcgaacccttccgagttcag
ttccacctgcaggaaaagttgctaaaacttaaaggctgtaaagatgataaatggggtctt
tgcgattggtctgttttcaagcagaattatggctccatttctaagacttgcaaccttgat
ttctgttga

DBGET integrated database retrieval system