KEGG   Zootermopsis nevadensis: 110831560Help
Entry
110831560         CDS       T05136                                 

Definition
(RefSeq) estradiol 17-beta-dehydrogenase 8 isoform X1
  KO
K13370  17beta-estradiol 17-dehydrogenase / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) / 3-oxoacyl-[acyl-carrier protein] reductase alpha subunit [EC:1.1.1.62 1.1.1.239]
Organism
zne  Zootermopsis nevadensis
Pathway
zne00061  Fatty acid biosynthesis
zne01100  Metabolic pathways
zne01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:zne00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    110831560
Enzymes [BR:zne01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     110831560
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     110831560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase 3Beta_HSD DUF4346
Motif
Other DBs
NCBI-GeneID: 110831560
NCBI-ProteinID: XP_021923404
Position
Unknown
AA seq 260 aa AA seqDB search
MAGNSFKIPNTDWEVNGDIIQNYFSAGSGIGRAVCQVLSREGAKVIAADQNAIAAQETKG
LISGVRCNDHISVSVDVSIAESVDMAISDAIRHYSKPPSVVVNSAGITLDNFLLKMDEKW
FQKVIDVNLKGTFLVVQAAVKAMIDAKVYGGSVINIASIVGKTGNIGQCNYSASKAGVEA
FTKTAAKEFGQFGIRCNAVVPGFIKSPMTDSVPEKVIQKIIPFIAVGRMGKPEEVAEVIA
FLASDRSSYVNGASIEVTGG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcggggaattcgtttaaaatcccaaataccgactgggaagtaaatggtgatatcata
caaaattatttcagcgccggcagtgggattggtcgtgctgtgtgtcaagtactgtctagg
gaaggagcaaaggtcattgctgcagatcagaatgcgatagcagctcaagaaacaaaaggc
ctcatctcaggtgttaggtgtaatgaccacatttctgtcagtgttgatgtgtccatagca
gaaagtgttgacatggctatcagtgatgccatcagacattattctaagcctccatcagtg
gtagtaaattctgcaggaattactttggataacttccttcttaagatggatgaaaagtgg
tttcagaaagttatagatgtcaatttgaagggtactttcctggtggttcaagctgcagtg
aaagctatgatagatgcaaaggtatatggaggttctgttataaatatagcaagcattgtt
gggaaaactggcaacattggtcagtgtaactattctgcaagcaaagctggtgtagaagct
tttaccaagacagccgccaaggagtttggacaatttggtatccgatgcaatgctgtagtg
cctggcttcatcaagagcccaatgactgacagtgtcccagaaaaagtaatacagaaaata
atcccattcatagcagtgggccgtatgggcaagccagaagaagtagctgaagtcatcgcc
tttctggcttcagacagaagttcatatgtgaatggagcatctattgaagttactggaggg
taa

DBGET integrated database retrieval system