KEGG   Zootermopsis nevadensis: 110832839Help
Entry
110832839         CDS       T05136                                 

Definition
(RefSeq) glucosylceramidase-like isoform X1
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
zne  Zootermopsis nevadensis
Pathway
zne00511  Other glycan degradation
zne00600  Sphingolipid metabolism
zne01100  Metabolic pathways
zne04142  Lysosome
Brite
KEGG Orthology (KO) [BR:zne00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    110832839
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    110832839
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    110832839
Enzymes [BR:zne01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     110832839
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_59
Motif
Other DBs
NCBI-GeneID: 110832839
NCBI-ProteinID: XP_021925902
Position
Unknown
AA seq 559 aa AA seqDB search
MTIYIYTGTHTTDRRLRYIRLHQIQTSFGKQRRHFQIRIMGRREETCKMHCAVVLRLLLI
FLPAMVCGQGCAPKNYGTNKVVCVCNATYCDNLHPPEELLQPGYYLQYTSTQTGKRLVPI
SMQMSKKAPSTGDVWKVTSSKQYQEIIGFGAAITDSVGINIGSLEKDVRESLLNQYYGPE
GIGYTLVRVPLGGTDFSTRFYTYDDGTADPTLSRFKLADEDYKYKLPYLKYIKQLSNPRV
VTVPWSPPEWMIEGRNGTEGFTRLKDIYYQVYAEYFVNFLNAYQKEGINFWGLTLQNEPG
NGYYVYFGINSCGYSPEEQRNFIANNLGPTLQKNNFGNIVIMAGDDQRTFLPESAQVVLD
NPAASKFVSGTAVHWYFDDQYPASRLTKLHDLFPDKFILYTEASFIPDSGSPAVLFGDWG
RAERLSKDILDVLNHWVTGWIDWNLALNTIGGPTYLNNNLDSPIIVNSTANEFYKQPIFY
SLAHLSKFVPPGSKRIQLNSTAESGVDNVAFLRPDNIVAVVLLNSKDDAKKISLQTDAGS
YISITVAAHSLNTIIYNKT
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgacgatatacatatatacaggcacacacacaactgacagacgcctaaggtacatacgt
ctacatcagattcagacatcgtttggaaagcaacgtaggcattttcagattcgaatcatg
ggaaggagagaggaaacctgtaaaatgcattgcgccgtggtcttgcgtctcctactaatt
tttctccctgccatggtgtgcggacaaggatgcgctcctaagaactacggcacaaacaag
gttgtctgtgtgtgtaacgccacgtactgtgataatctacacccgccagaagaacttctt
cagcccggatattatctccaatacacctcaacacagaccggaaaacgtctagtacctata
tcaatgcaaatgtcgaagaaagctccctctactggcgacgtgtggaaagtgacgagttca
aagcagtaccaagaaataattggcttcggcgcagcgataactgattctgtgggtatcaac
attggctcactagaaaaggatgtcagagaatctctactcaaccaatactacggcccagaa
ggcatcggttacacattggttcgagtcccgttaggtggaactgatttctcaactaggttc
tacacttacgatgacggcactgctgaccctacactgtctcgctttaagctagcggatgaa
gattataaatacaagctcccttatctgaaatacatcaaacagctgtctaaccccagggtg
gtaactgttccttggtcaccaccggagtggatgatagaaggaagaaatggcactgagggg
tttacacgactcaaggacatttattaccaggtgtacgctgaatattttgtcaatttcttg
aatgcctaccagaaggaaggcataaatttttggggtctgacccttcaaaatgagcccgga
aacggatactacgtttacttcggtattaacagctgcgggtattcccccgaagaacagcgt
aacttcatcgccaataacttgggccccacacttcagaaaaacaactttggcaacattgtc
atcatggctggtgacgaccagagaacatttcttcccgaatctgctcaagtggtactggac
aacccggcggcttctaaattcgtcagcggcacggccgtccattggtacttcgacgaccag
tacccggcgtctcgtcttacgaaactccacgatttgtttccagacaaattcatcctgtac
accgaggcctccttcattccagactcgggttcgccagctgtccttttcggagactgggga
cgagcagaaaggttatcgaaggacatactcgatgtactgaaccactgggtgaccggctgg
atcgactggaaccttgcactcaacaccatcggaggaccaacttacctgaacaacaatctg
gactctcccattattgtgaactctactgccaacgagttctacaaacaacccattttctat
tcactggcccatctgtccaaattcgtgcctcccggatcaaagcgcatccaactaaattct
acagctgaaagtggagtcgacaacgtggctttcctcagacccgacaacattgtggcagtc
gtgcttctcaacagtaaggacgacgccaaaaagatttctctgcagacagacgcaggctcg
tacatctcgatcacagtagctgcacactcgttaaatacaatcatctacaacaaaacctag

DBGET integrated database retrieval system