KEGG   Zootermopsis nevadensis: 110834487Help
Entry
110834487         CDS       T05136                                 

Definition
(RefSeq) aromatic-L-amino-acid decarboxylase-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
zne  Zootermopsis nevadensis
Pathway
zne00350  Tyrosine metabolism
zne00360  Phenylalanine metabolism
zne00380  Tryptophan metabolism
zne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zne00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    110834487
   00360 Phenylalanine metabolism
    110834487
   00380 Tryptophan metabolism
    110834487
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:zne04147]
    110834487
Enzymes [BR:zne01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     110834487
    4.1.1.105  L-tryptophan decarboxylase
     110834487
Exosome [BR:zne04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110834487
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 110834487
NCBI-ProteinID: XP_021929381
Position
Unknown
AA seq 512 aa AA seqDB search
MDATEFRKFGKAAVDYLADYLENLRDRPVLPSVEPGYLQNLIPGDAPEQPEKWQDILVDI
ERVIMPGVTHWHSPHFHAYYPTANSYPGIVGEMLSAGIGCIGFSWITSPACTELEVAMMD
WLGKLIQLPREFLNCSDGPGGGVIQGSASEATLVGLLAAKERSVRRIQKLHPDWDEGTIK
AKLVAYSSDQSNSSVEKAGLLGSMPMRLLPTDEKCRLRGATLEQAIKSDRERGLIPCYVV
ATLGTTGTCAFDCLEELGPICNKEELWLHVDAAYAGSAFICPEFRHLMAGVNYADSYNFN
PHKWMLVNFDCSAMWVKDSQYLIEAFSVDRIYLKHQHQGRTPDYRHWQIPLGRRFRSIKL
WMVLRLYGAEGLQQHIRRQVGLAREFEALLRGDSRFEIVTDISMGLVCFRLKGADSLTKN
LHERLMESKKIYIIAATFRDKHILRFVVCSRITESRDIAFAWEEIRSQAEQVLHSDAPVH
FPKTHNHVKFNGLRKNCPNNELKVNGNTNGQG
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggatgccacggagttcagaaagttcggtaaagctgctgtcgactacctagccgattac
ctggaaaatctacgggacagaccggtactgccttcagtggagcccggctacctacaaaac
cttatcccgggggacgcgccagagcagccagagaagtggcaggacattctcgtcgacatt
gaacgggtcatcatgcccggggtcacgcactggcattcgccacattttcatgcgtactat
ccaactgcaaactcctatcccggaatcgtgggagaaatgctgagtgctggcattggctgc
atcggatttagctggatcacgagtcctgcttgcactgagcttgaggtggccatgatggat
tggctgggaaagctcatacagcttccccgcgagttcctcaactgttccgatggtccaggt
gggggcgtcatccagggatcggcgagcgaagcgacactggtgggtttgctcgcagccaag
gagcgatcggtcaggaggatccaaaagctacatcctgactgggacgaaggaacgatcaag
gcgaagctcgtagcctactcttcagatcaatccaactcttctgtagagaaggcaggatta
ttgggttctatgcccatgcgcctcttaccaacagatgaaaaatgccggctgaggggagca
accctggaacaagccatcaagagcgaccgggagaggggccttatcccttgctacgtggtg
gcgacgctaggaactacaggaacgtgcgccttcgactgtctggaagagttgggtccgatc
tgcaacaaagaagaactctggctacatgtcgatgccgcgtatgcagggtctgcgtttatc
tgtcctgagttcagacacctcatggctggagtaaattatgcggattcttacaacttcaac
ccacataagtggatgctcgtaaattttgactgttcagcaatgtgggtaaaggactcgcag
taccttattgaggcgtttagtgtggatcgaatttacctgaagcatcaacatcaaggccga
acgccagactacaggcactggcagattccactcggccgtcgattccggtccatcaaactg
tggatggtgttgaggctgtacggggcagagggccttcaacagcacatccgacgacaagtg
ggactggcacgtgagttcgaggccctcttgcggggagacagccgctttgagatagtcaca
gatatcagcatgggcctcgtctgctttcgccttaagggcgcagactctctgacgaagaac
ctccacgagcgtctaatggagagtaagaagatctacataatagccgctacattccgggac
aagcacatcctccggtttgtggtgtgtagccgcatcacggaatcgcgagacatcgccttc
gcatgggaggagatccgtagtcaggctgagcaagtcctgcacagtgacgcaccggtccac
ttccccaagacacacaaccacgttaaatttaacgggcttcggaagaactgtcccaacaat
gagctcaaagtcaacggaaacacaaatgggcaaggataa

DBGET integrated database retrieval system