KEGG   Zootermopsis nevadensis: 110834632Help
Entry
110834632         CDS       T05136                                 

Definition
(RefSeq) alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
zne  Zootermopsis nevadensis
Pathway
zne00510  N-Glycan biosynthesis
zne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zne00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    110834632
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:zne01003]
    110834632
Enzymes [BR:zne01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     110834632
Glycosyltransferases [BR:zne01003]
 Glycan extension
  N-Glycan
   110834632
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGAT2
Motif
Other DBs
NCBI-GeneID: 110834632
NCBI-ProteinID: XP_021929706
Position
Unknown
AA seq 495 aa AA seqDB search
RTASCVRTAVFLFLVTFVWLQLHVASLNGNRQAPGTDTSESNDSTAAILSMVPQVLHKFL
TPKPRNSSHAVVGTNVSEGAGAVGLIGPNAGRASSPNISDIRRNIERYNDMQQVLNEELF
GPVQNDSLIIVVQVHTRIIYLRHLIVSLAQARDIDTVLLVFSHDYYDEEINELVQSVDFC
KVMQIFYPYSIQTHPKEFPGESPGDCPRNIKKEQAKEMLCNNALYPDLYGHYREAKFTQT
KHHWWWKANRVFNQLEVTRNHTGMVLFLEEDHFVAEDFIHVLRLMERTCHTSCNRCNILS
LGTYLKTYNYYGDSKKKEAQRALKRHQTFSPGSIPPSWSFQILPTLYQHYQKAEVTPWIS
SKHNMGMAFNRSTWLDVRHCAEFFCTYDDYNWDWSLQHISQGCLNHKLYAMVMKGPRVFH
IGECGVHHKKANCESTAVISKVQQVLKYASKHLYPNYLTLTVTNTNKKQKLRKGNGGWGD
VRDHQLCINMTRSGR
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
cgcacggcttcctgtgtgcgcaccgccgtcttcctgttcctggtcacattcgtatggctc
cagctgcacgtggccagtctcaatggaaacaggcaagcccctggaactgacacttcggag
agcaacgactccaccgccgccatcctcagcatggtgcctcaggtactgcacaagttcctg
acgccgaagcctcgaaacagcagccatgcagtggtgggcaccaatgtcagtgaaggagca
ggggcagtaggcctgatcgggccgaacgctggtcgggcttcttcccctaacatctcggac
atccgccgtaacattgagcgctacaacgacatgcagcaagtactgaacgaggagctcttt
ggtcccgtgcagaatgactctctcatcattgttgtgcaagtacacacgcgcatcatctac
ttgcgacacctgatcgtgagcttggcgcaggcacgggacattgacacggttcttttggtg
ttcagtcacgactactatgatgaggagatcaacgagctggtccagagtgtagacttctgc
aaggttatgcagatcttctacccctactctatacagacgcatccgaaggagttccccggc
gagtcgcccggagactgccctcgcaacatcaagaaggagcaggcgaaggagatgctgtgt
aacaacgcactgtatcctgatctgtacgggcattaccgagaggcaaagttcacgcagaca
aaacaccactggtggtggaaagcgaacagggtgttcaaccagctggaggtgacacggaac
catacaggcatggttctgtttctggaggaagaccactttgtagctgaggatttcatccat
gtgctgcggttgatggagagaacgtgccacacaagttgcaaccgctgcaacattctttcg
ctggggacgtacctcaagacgtacaactactatggggactccaagaagaaggaggctcag
agagccctgaaacgtcatcagactttctctccagggtcaatccctccatcttggagcttc
cagatcctccccactctttatcagcactaccagaaggcggaggtgacgccgtggatcagc
agcaagcacaacatgggaatggctttcaaccgcagcacgtggctggatgtacgtcactgt
gccgagttcttctgcacgtacgatgactacaactgggactggagtctgcagcatatttct
cagggttgcctgaatcacaagctgtatgcgatggtcatgaagggccctcgtgtcttccac
atcggggagtgtggagtccaccacaagaaagcgaactgtgaatccacagcagtgatatcg
aaagttcagcaagtgctaaagtatgccagcaaacatctgtatccaaattacctaacactc
actgtgaccaacacgaacaagaagcagaagttgcgtaaaggtaatggtggctggggtgat
gtgcgggatcaccagctctgcatcaacatgactcgctcgggaaggtag

DBGET integrated database retrieval system