KEGG   Zootermopsis nevadensis: 110836680Help
Entry
110836680         CDS       T05136                                 

Definition
(RefSeq) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
zne  Zootermopsis nevadensis
Pathway
zne00020  Citrate cycle (TCA cycle)
zne00310  Lysine degradation
zne00380  Tryptophan metabolism
zne01100  Metabolic pathways
zne01200  Carbon metabolism
Module
zne_M00009  Citrate cycle (TCA cycle, Krebs cycle)
zne_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:zne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    110836680
  09105 Amino acid metabolism
   00310 Lysine degradation
    110836680
   00380 Tryptophan metabolism
    110836680
Enzymes [BR:zne01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     110836680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl HlyD_D23 Biotin_lipoyl_2 DUF2797
Motif
Other DBs
NCBI-GeneID: 110836680
NCBI-ProteinID: XP_021933806
Position
Unknown
AA seq 477 aa AA seqDB search
MAGMLTFSSRNLPQNVLRLTSKVFEIKSFQVSLKSRSYHQGRACNKWARHVCVQRFKQNG
QRTKCHQHWYPVLRHFQSSAALCDEIKIVTVPQFAESVSEGDVRWEKAVGDTVAEDEVVL
EIETDKTSVPVPAPGAGVIEERFVDDGATVKTGEKLFKLKLIAGGVAAAPAKKKEAVAAE
PSPPPPPAAAAAPPPPPRPPPPPPPPPPQGPISSIPVAAIRHAQAIEAATVKLPPADPTS
EITGTRSEQRVKMNRMRQRIAQRLKEAQNTNAMLTTFNEIDMSNIMEFRKAHLEAFQKKY
SIKFGFMSAFVKAAAFALQDQPVVNAVIDGSEIIYRDYVDISVAVATPKGLVVPVVRNVE
SMNYAEIELAIAALGEKAKKGALAVEDMDGGTFTISNGGVFGSLMGTPIINPPQSAILGM
HAIFDRPVAIKGQVVIRPMMYVALTYDHRLVDGREAVLFLRKIKAAVEDPRTILLGI
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggctggtatgctcactttttcttcgcggaatcttccgcagaatgtactgaggctaacg
tcgaaagtatttgaaataaaaagttttcaggtgagcttgaaatcacgatcttatcaccaa
ggacgagcgtgtaataaatgggcgcgacatgtttgtgtacaacgtttcaaacaaaatggt
caacgaacaaaatgccaccaacattggtaccctgttttacgacattttcagtcatccgct
gctttatgtgatgaaataaaaatagtgaccgttcctcaatttgcagagtcagtttcggaa
ggagatgtgaggtgggagaaagctgtgggagataccgtagctgaagatgaagttgtgtta
gaaattgaaacagataagacttcggtccccgttcctgcaccaggtgctggtgttatagaa
gaacgttttgtggatgatggagccactgttaagactggagagaaactcttcaagcttaag
cttatagcgggaggagttgctgctgctccagcaaagaagaaagaagctgtggcggcggaa
cctagcccccctccgccaccggcagctgcggcagctcctccacctccgccgcgacctcca
ccgccacctcctccacctccaccccaaggaccaatttcttcgatcccagtggctgctatc
cgacatgctcaagccatcgaagctgcaactgttaagctgccacctgcagatcctacatct
gaaattactggaacacgatctgaacagcgagtcaagatgaatcgaatgaggcagcgtata
gcacagcgtctcaaagaggctcaaaacacaaatgctatgcttactacatttaatgagatt
gatatgagtaacattatggagttccggaaagctcacttggaagcattccagaaaaaatac
agtatcaagtttggcttcatgtctgcgtttgtcaaagcagctgctttcgcgctacaggac
caaccagttgtgaatgcagtaatcgatggcagtgaaataatataccgtgattatgtggat
atctctgttgctgtggccactcccaagggtttagtcgtaccagtagtacgaaacgtagaa
tcaatgaattatgccgaaattgaactggcaatcgctgccctgggagaaaaggcgaagaag
ggtgcattagctgttgaagatatggatggaggaacattcaccatcagtaatggtggtgtg
tttggttccctgatgggaacacccatcatcaatcctcctcaatcagctattctaggcatg
catgcaatttttgacagacctgtggccataaaaggacaggttgtcatcaggcctatgatg
tatgttgcgttaacatacgatcatcgtcttgtcgatgggcgtgaagcagttcttttcctg
cgtaaaatcaaagcagcggtggaagacccaaggacaattttgctgggtatatag

DBGET integrated database retrieval system