KEGG   Zootermopsis nevadensis: 110837359Help
Entry
110837359         CDS       T05136                                 

Definition
(RefSeq) atrial natriuretic peptide receptor 2-like
  KO
K12323  atrial natriuretic peptide receptor A [EC:4.6.1.2]
Organism
zne  Zootermopsis nevadensis
Pathway
zne00230  Purine metabolism
zne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zne00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110837359
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:zne01001]
    110837359
Enzymes [BR:zne01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     110837359
Protein kinases [BR:zne01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   110837359
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA
Motif
Other DBs
NCBI-GeneID: 110837359
NCBI-ProteinID: XP_021935075
Position
Unknown
AA seq 324 aa AA seqDB search
MDDLLRRMEQYANNLEALVEEKTAQLSQEKRRSEELLYQVLPRPVAHQLMAGEMVQPEQF
ESVTVYFSDIVGFTALCAQSTPMQVVNFLNDLYSTFDRIIGFYDVYKVETIGDAYMVVSG
LPQRNGDDHAREISLMALAILGAVNSFTIKHKPEAQLRIRIGIHSGPVCAGVVGQKMPHF
CLFGDTVNTASRMESTGQPLRIHVSDDARQILDKFGTFQLELRGEVELKGKGCFTTYWLL
GCSRGLVRNQFSVQGDIPKFVDSSKSHFLAAAFFRSDLPLISSSGAIARATASSVGKSKE
YKVLFGMWSVSYNGVSGSQGSMAV
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggatgatctgctaagacggatggaacagtatgccaataacttggaagccttggtggag
gaaaagactgcacagctgagtcaggaaaagcgccgctctgaggaactcctctaccaggtg
ttacccaggcctgtagctcatcagctgatggcaggggaaatggttcaaccagagcagttt
gagagtgtgacagtgtacttcagtgatattgttggattcacagctctttgtgctcagagc
acaccaatgcaggttgtaaacttcctcaatgatttatacagcacttttgacagaataatt
gggttttatgatgtatacaaggtggaaacaattggtgatgcttatatggtggtgtctgga
ttaccccaaaggaatggagatgatcatgctcgagagatttcactcatggccctagcaatt
cttggcgctgttaactcatttacaattaaacacaaaccagaagcacaactcagaatacga
attgggattcactcaggacctgtgtgtgcgggagttgttggacagaagatgcctcacttt
tgtctgtttggggacacagtaaacactgcttcaagaatggaatccactggccagcctcta
agaatccatgtgagtgatgatgctcgccaaattctggacaagtttgggacattccagcta
gagcttcgaggagaagtagagcttaagggtaagggctgcttcacaacatattggctgctg
ggttgcagcagaggacttgtgaggaaccaattctcagtgcaaggtgatataccaaaattt
gtggattcatcaaagtcccatttcctggctgctgcattctttagatctgacctgcctttg
atttcttcttctggggctatagcaagggccactgccagcagtgttggaaaaagtaaagaa
tacaaagtactgttcgggatgtggtcagtgagctataatggggtgtctggctcacagggt
tcaatggctgtttag

DBGET integrated database retrieval system