KEGG   Zootermopsis nevadensis: 110838756Help
Entry
110838756         CDS       T05136                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: alanine--glyoxylate aminotransferase 2-like
  KO
K14286  ethanolamine-phosphate phospho-lyase [EC:4.2.3.2]
Organism
zne  Zootermopsis nevadensis
Pathway
zne00564  Glycerophospholipid metabolism
zne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zne00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    110838756
Enzymes [BR:zne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.2  ethanolamine-phosphate phospho-lyase
     110838756
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-GeneID: 110838756
NCBI-ProteinID: XP_021937991
Position
Unknown
AA seq 486 aa AA seqDB search
MDSQEKIPKCETIRLRKRHVGQSCKLFYRSDPLKIVRAVGQYMYDEKGRQYLDCINNVAH
VGHCHPDVVKAACDQLAVLNTNNRFLHDNLVLCARKLTSLLPEPLSVCFFVNSGSEANDL
ALRLARAHTKNHDVITLDHAYHGHLTSLIDISPYKFDHAGGSGKPEWVHVASCPDVYRGK
YRDVDHPGKDLGKMYADEVRDICKKAREDGHTIAAFIAESLQSCGGQIIPPDNYLCNVFR
YVREAGGVCIADEVQVGFGRVGKHWWAFQLQGEDIVPDIVTVGKPMGNGHPVAAVITTVE
IAHSFKETGIEYFNTYGGNPVSCAVASAVIDVLEQQXXXXXXXXXXXXXLSSAXLALKHP
IVGDVRGVGLFIGIDLVEDQGTRIPATAKAQHIVSRMKEEYILVSSDGPDRNVLKLKPPL
VFSHENVDHFVKILDEVLTEINDDEVNMEASSPQREKMTNDSEYQSSPNEKKIKIDDQQS
EKIIKI
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggattcacaagaaaagataccaaaatgcgagactatacggctgagaaaacgccacgtg
gggcaatcgtgcaagctgttttatcgatccgaccccttgaagatcgttagggcagtgggt
cagtatatgtacgatgagaagggcagacaatatttggattgcatcaacaatgttgcccat
gttggccactgccatccagatgtagtgaaggcagcatgtgaccaactggcagttctcaac
acaaacaaccgctttctgcatgacaatctggtgctctgtgctcgcaagctgacgagtctg
ttgcccgaacccctctcagtctgcttctttgtcaattcaggctctgaggcaaatgacttg
gctctccgccttgcaagggcccacaccaagaaccatgatgtcatcacgctggatcatgct
taccatggccacttgacatcactgattgatatttcaccttacaaatttgatcatgcagga
ggcagcggaaaaccagaatgggttcatgtagcttcatgtccagatgtgtatcgcgggaag
tacagggatgtggaccatcctggaaaggatctggggaagatgtacgcagatgaagtgcgt
gacatctgcaagaaagcacgtgaagatggacacactattgcagcattcatcgcagagagt
ctacagagttgtgggggtcaaataattcctccagataattacttgtgtaatgtattcaga
tacgttcgagaggcaggcggagtatgcattgccgatgaggtgcaggttgggttcggtcgt
gttggcaagcactggtgggcattccagcttcagggggaggacatcgttcctgatatcgtt
acggttggcaaaccgatggggaacggccatcctgttgctgcagtcatcacaactgtggaa
attgcccatagcttcaaggagactggcattgaatatttcaatacatatggtggaaaccca
gtgtcatgtgcagttgccagcgctgtaatagatgtcctagaacaacagaannnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnctctcttcggcannactggcactaaagcacccc
attgtcggagatgtgagaggagtggggctttttataggcattgatttagtcgaggatcag
ggcacgaggataccagcaacagccaaggcgcagcatatagtgtccagaatgaaggaggaa
tatatcttggtgagctcggacggtcccgaccggaatgtactgaagctgaaaccaccctta
gtgttcagtcatgagaatgttgaccattttgttaaaattctggatgaagttctcacagaa
atcaatgatgatgaggttaacatggaagcaagttccccccagagagaaaagatgaccaat
gactcagaatatcagagttcacccaatgagaagaagataaaaatcgatgaccaacaatca
gagaaaataattaagatctga

DBGET integrated database retrieval system