KEGG   Zootermopsis nevadensis: 110840352Help
Entry
110840352         CDS       T05136                                 

Definition
(RefSeq) heat shock 70 kDa protein cognate 4 isoform X1
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
zne  Zootermopsis nevadensis
Pathway
zne03040  Spliceosome
zne04141  Protein processing in endoplasmic reticulum
zne04144  Endocytosis
zne04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:zne00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110840352
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110840352
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110840352
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    110840352
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:zne01009]
    110840352
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:zne03041]
    110840352
   03009 Ribosome biogenesis [BR:zne03009]
    110840352
   03110 Chaperones and folding catalysts [BR:zne03110]
    110840352
   04131 Membrane trafficking [BR:zne04131]
    110840352
   03051 Proteasome [BR:zne03051]
    110840352
   03029 Mitochondrial biogenesis [BR:zne03029]
    110840352
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:zne04147]
    110840352
Protein phosphatases and associated proteins [BR:zne01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     110840352
Spliceosome [BR:zne03041]
 Complex B
  Other components
   Prp19 complex
    110840352
 Complex C
   Prp19-CDC5 complex
    110840352
Ribosome biogenesis [BR:zne03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    110840352
Chaperones and folding catalysts [BR:zne03110]
 Heat shock proteins
  HSP70 / DNAK
   110840352
Membrane trafficking [BR:zne04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    110840352
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    110840352
Proteasome [BR:zne03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    110840352
Mitochondrial biogenesis [BR:zne03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    110840352
Exosome [BR:zne04147]
 Exosomal proteins
  Proteins found in most exosomes
   110840352
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DUF1464 Hydantoinase_A Zincin_2
Motif
Other DBs
NCBI-GeneID: 110840352
NCBI-ProteinID: XP_021941010
Position
Unknown
AA seq 673 aa AA seqDB search
MNTENSCRCCVNGQWFIYLGFNMATTPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTT
PSYVAFTDTERLIGDAAKNQVAMNPNNTIFDAKRLIGRRFDDLTVQADMKHWPFTVVNDS
TKPKIQVQYKGETKTFFPEEVSSMVLTKMKETAEAYLGKSVTNAVITVPAYFNDSQRQAT
KDSGAIAGLNVLRIINEPTAAAIAYGLDKKGHGERNVLIFDLGGGTFDVSILTIEDGIFE
VKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLTSNKRAVRRLRTACERAKRTLSSST
QASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVG
GSTRIPKVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILAGDKSEEVQDLLLLDVTP
LSLGIETAGGVMTILIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGK
FELTGIPPAPRGVPQIEVTFDIDANGILNVTAVEKSTGKENKITITNDKGRLSKEDIERM
VNDAEKYRAEDEKQKQTISAKNALESYCFNMKSTMEDEKLKDKISEADKTTVMDKCNEVI
RWLDANQLAEKEEFESQQKELESVCNPIMTKLYQGAGGIPGGMPGGFPGAAGGAPGAGGA
AGAGAGPTIEEVD
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgaacacagaaaacagttgcaggtgctgtgttaatggacagtggttcatttatttagga
ttcaatatggcaactacaccagctgttggtattgatcttggcacaacctactcatgtgtt
ggcgtgttccaacatggaaaggttgaaatcattgctaatgaccaaggaaacaggacaaca
cctagttatgtagctttcacagatacagaaagattgatcggagatgcggctaagaaccaa
gtggctatgaaccccaataacacgatttttgatgcgaaacgtcttattggacgtcggttt
gatgatcttaccgtgcaagcagacatgaaacattggccattcacagttgtgaatgatagt
actaaaccaaagatacaagttcagtacaaaggagaaacaaagactttcttccccgaagag
gtgagctccatggtgctgacgaagatgaaggaaactgctgaggcgtacctcggcaagtct
gtgacaaatgctgtcatcacggtccccgcctacttcaatgattcccagaggcaagccaca
aaggattctggtgcgatcgcgggtctgaatgtactccgaatcattaacgaacctacagct
gcggctatcgcatatggccttgacaaaaaggggcatggagaacgcaatgttctgatcttc
gacttgggcggtggtacttttgatgtctccatccttaccattgaagatggaatctttgaa
gtaaagtctactgctggagacactcatcttggcggtgaagattttgacaaccgcatggtc
aaccactttgtccaagaattcaaacgcaagtacaagaaggacttgacctcaaacaagcgc
gcagtcagaagactgcgtaccgcctgcgaacgagcgaagcgcacgctttcatcctccact
caagccagcatcgagatcgattcgctgtttgaaggcatcgatttctacacgtccatcacc
cgagccagattcgaagagctaaatgcggacctgttccgtagcaccatggagccggttgag
aaatccctccgagatgccaagatggacaaggcgcagattcacgatattgtcctagttggc
gggtcaacacgcattcctaaggttcagaaattgctccaagacttcttcaacgggaaagag
ctgaacaagtcgatcaaccctgatgaggcagtggcgtatggagcggctgtacaggcagca
atcttggctggagacaagtcggaggaggttcaggacctgcttctgctggacgtgactcct
ctttctcttggtattgagacagctggaggagtgatgactatcctcataaagcgtaacaca
accatccccacaaagcagacccagacatttactacctactcagataaccagccaggtgtg
ttgatccaggtatacgagggcgaacgagccatgaccaaggataacaacctgctcggaaag
tttgaactcaccggaattcctcccgcaccgcgaggtgtccctcagattgaggtgactttc
gatatcgatgctaacggtattctgaacgtaacggccgtagagaagtcgaccggaaaggag
aacaagatcacgatcacaaatgataagggtcggctgagcaaggaggacatcgaacgtatg
gtgaatgatgcggagaaataccgcgctgaagatgaaaagcagaagcagaccatttctgcc
aaaaatgctttggagtcgtattgcttcaacatgaagagtacgatggaggatgagaaactg
aaggataagatctcggaagctgataaaactaccgtcatggacaaatgcaacgaggttatc
cgctggctggatgccaaccagcttgctgagaaggaagaatttgagtctcagcagaaggag
ctggagtcggtctgcaatccgataatgacgaaactctatcagggtgctggcggtattcct
ggagggatgccaggaggattcccaggtgctgctggcggcgcgccaggggctggtggagca
gccggcgcaggagcaggaccaactatcgaggaagtcgattaa

DBGET integrated database retrieval system