KEGG   Zootermopsis nevadensis: 110840717Help
Entry
110840717         CDS       T05136                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase H
  KO
K09567  peptidyl-prolyl isomerase H (cyclophilin H) [EC:5.2.1.8]
Organism
zne  Zootermopsis nevadensis
Pathway
zne03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:zne00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110840717
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:zne03041]
    110840717
   03110 Chaperones and folding catalysts [BR:zne03110]
    110840717
Enzymes [BR:zne01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     110840717
Spliceosome [BR:zne03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6 snRNP specific factors
    110840717
Chaperones and folding catalysts [BR:zne03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    110840717
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 110840717
NCBI-ProteinID: XP_021941634
Position
Unknown
AA seq 184 aa AA seqDB search
MPTWNQIQSQLRNPNNPVVFFDISVGTTEIGRMILELFADVVPKTCENFREFCTGEYRRD
GVPLGYKGAIFHRVIKDFMIQGGDFVNGDGTGVMSVYGGGTFADENFNLKHDAPGLLSMA
NSGKDTNGCQFFITCAKCNFLDGKHVVFGRVVDGLLVMRKIENVPTGPNNKPKIPVVISQ
CGQM
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgccgacatggaatcagattcagtcacaattacgaaatccgaacaatcctgtagtattt
tttgacataagcgtcggtacgactgaaattggacgaatgatacttgaattgtttgcagat
gttgtacctaagacatgtgaaaatttcagagaattttgtacgggggagtatcgaagagat
ggtgtgcctcttggttataagggagcaatattccaccgtgttatcaaagacttcatgatt
cagggtggagattttgtaaatggtgatggtactggagtgatgagtgtctatggcggagga
acatttgcagatgagaacttcaacttgaagcatgacgctcctggtttattgtcaatggca
aacagtggtaaagatacaaacgggtgccagtttttcattacatgtgcaaagtgcaacttc
ttggatgggaaacatgttgtgtttggtagggtcgtagatggactgttagtgatgaggaaa
atagaaaacgttcctacaggtccaaacaacaaaccaaaaattccagttgtcatatcacag
tgtggccaaatgtaa

DBGET integrated database retrieval system