KEGG   Zoogloeaceae bacteirum Par-f-2: C3497_04855Help
Entry
C3497_04855       CDS       T05440                                 

Definition
(GenBank) 23S rRNA (cytidine(2498)-2'-O)-methyltransferase RlmM
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
zpa  Zoogloeaceae bacteirum Par-f-2
Brite
KEGG Orthology (KO) [BR:zpa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:zpa03009]
    C3497_04855
Enzymes [BR:zpa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     C3497_04855
Ribosome biogenesis [BR:zpa03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    C3497_04855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AVZ78847
UniProt: A0A2S0QVB2
Position
complement(1024542..1025633)
Genome map
AA seq 363 aa AA seqDB search
MSSALPAGLLVSGLLAYCRAGFEKELAAELDELAANAGLIGHVRAKPGTGFAVYQSLEAL
PATAFEGLADWRRPVFARQLLLWFAHITDLPERDRASPLRDAVKASRQRFGALVLETPDT
DEAKQRSGFCRRFTAPLSRTLEQAGALRPDQTALPVLHVMFESATTAWLAAAMPQDSSPW
PMGIPRLRMPGGAPSRSTLKLSEAFITLLSEDERQTSLRAGLRAVDLGASPGGWTWQLAS
RGLHVTAVDNGPLSASVMATGMVEHLRADGFTWRPPRAVEWMVCDMVEQPSRIAALVADW
VATGRCRRSIFNLKLPMKRRLDAVAQCRALIHKRLASVGPYDLRIKHLYHDREEVTAYLA
LRR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccgccctgcctgccggcctgttggtttccggattgctggcatactgccgcgcc
ggttttgaaaaagagctggccgccgaactcgacgaactggctgccaacgccggtttgatt
ggccatgtgcgcgccaagcccggcaccggctttgcggtttaccagagcttggaggcgctg
cccgccaccgccttcgagggccttgccgactggcgccgtccggtttttgcccgccaactg
ctgttgtggttcgcacacatcaccgatctccccgagcgcgaccgcgccagtccgctgcgc
gacgcggtcaaagcgagccgccaacgctttggcgcgttggtgctggagaccccggatacc
gacgaagccaagcagcgctctggcttctgccgccgtttcaccgctcctttgagccgcacg
ctggagcaggccggtgcgctgcgtcccgaccaaaccgctttgccggtgctgcatgtgatg
ttcgagtccgccaccaccgcctggttggccgcggccatgccacaggacagctcgccctgg
ccgatgggtattccgcgcctgcgcatgcccggcggcgcccccagccgttccacgctgaag
ctctcggaagcgttcatcaccctgctcagcgaagacgagcgtcaaaccagcctgcgtgcc
ggtttgcgcgcagtggacctgggcgcttcgcccggcggctggacctggcagctcgccagc
cgcggcctgcatgtcactgcggtggacaacggtccactgagcgcctcggtcatggccacc
ggcatggtcgagcatctgcgcgccgacggttttacctggcgaccgccgcgcgcggtggag
tggatggtctgtgacatggtcgaacaaccctcacgaatcgccgcgctggtggccgactgg
gtcgccaccgggcgttgccggcgcagcattttcaacctcaagctaccgatgaaacgccgc
ctggatgcggtggcgcaatgccgcgcgctgatccacaaacggctggccagcgtcggcccc
tatgatctgcgcatcaaacatctgtatcacgaccgcgaagaagtcaccgcctatttggcg
ctgcgcaggtaa

DBGET integrated database retrieval system