KEGG   Zoogloeaceae bacteirum Par-f-2: C3497_06840Help
Entry
C3497_06840       CDS       T05440                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
zpa  Zoogloeaceae bacteirum Par-f-2
Pathway
zpa00480  Glutathione metabolism
zpa00590  Arachidonic acid metabolism
zpa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zpa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    C3497_06840
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C3497_06840
Enzymes [BR:zpa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     C3497_06840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AVZ79178
UniProt: A0A2S0QTR8
Position
complement(1448504..1449007)
Genome map
AA seq 167 aa AA seqDB search
MNGATTVFDFTLRALDGQPMPLSHYRGQVLLLVNVASQCGLTPQYAGLQRLQDTFADRGF
TVIGFPCNQFGGQEPGDAAQIAAFCEKNYGVSFPLSEKIDVNGPGAHPLYQWLCAAAPGV
LGTEAIKWNFTKFLTDRQGRVVARYAPTTTPEALVCDIDKLLDTPTG
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcgcgaccacggttttcgatttcaccctgcgtgcgctcgatggccaacccatg
ccactttcgcattatcgcgggcaggtactgctgctggtcaatgtcgccagccaatgcggt
ctgaccccgcagtatgcgggcctgcagcggctacaggacaccttcgccgaccgcgggttt
accgtcatcggttttccgtgcaaccaatttggcggccaggaaccgggcgatgcggcgcag
attgccgcgttttgcgagaaaaactatggcgtgagttttccgctgagcgagaaaatcgat
gtcaatggccccggcgcgcatccgctctaccaatggctgtgcgccgccgcgccaggcgtt
ttgggcacagaagccatcaaatggaacttcaccaagtttctgaccgatcgccagggcagg
gtggtcgcccgttatgcaccgaccactacgcccgaagcgctggtgtgcgacatcgacaaa
ctgctcgataccccgaccggttga

DBGET integrated database retrieval system