KEGG   Zoogloeaceae bacteirum Par-f-2: C3497_10670
Entry
C3497_10670       CDS       T05440                                 

Definition
(GenBank) transporter
  KO
K15725  outer membrane protein, heavy metal efflux system
Organism
zpa  Zoogloeaceae bacteirum Par-f-2
Brite
KEGG Orthology (KO) [BR:zpa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:zpa02000]
    C3497_10670
Transporters [BR:zpa02000]
 Other transporters
  Pores ion channels [TC:1]
   C3497_10670
SSDB
Motif
Pfam: OEP
Other DBs
NCBI-ProteinID: AVZ79842
UniProt: A0A2S0QZR3
Position
complement(2249404..2250669)
AA seq 421 aa
MFRRICINWLPGLLLGLAASGAWAQAAAPASPAVTTLRQAFDAAWARQPEAQSLDMRRAA
ALARRESADSWSAEPPAFEVSGKTDQLHRNDGSREYEIGLAVPLWLPGERAATAALADAE
MRASTSRTLAAQLRTAAAVRAAYWDWQRARIDILVARERLASARELAADVSKRVRAGDLA
RADQHQADGAVATAEASLAEARGALAGAEQQLRALTGMTPALAAEGLSVAEAEPAPGGNS
VPLEARHPALAELRDRAELAQRSMTLAGIQGRANPELYLATTRERGASGESWQQTVTIGV
RIPFGSDTRNRARVANASAEAIEAETQLRLERERLTAEVDTARVRVESARTLVASAEQRA
HLARESRGFFEKAFRLGETDLPTRLRIELEAAEAERQVARTRIELAAAVSALRQAMGLLP
E
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgtttcgaagaatttgcatcaactggctgccggggctgctgctcggactcgcggccagc
ggggcgtgggcgcaagccgcggcccctgcatcacctgccgtaaccacgctcaggcaggcg
ttcgacgccgcgtgggcgcgtcagcccgaggcgcagtcgctcgacatgcgccgggcggcg
gcgctcgcgcgacgcgagagtgccgacagctggtcggccgaaccgccggccttcgaggtg
tcgggcaagaccgaccaactccaccgcaacgacggcagccgcgaatacgagatcggcctc
gcggtgccgctgtggttgcccggcgaacgcgcagcgaccgcggctctcgccgatgccgaa
atgcgtgcgagtacgagccgcacgcttgcggcacagctgcgcacggccgccgcggtgcgg
gccgcgtactgggattggcagcgcgcgcggatcgacatcctggtcgcccgcgagcggctt
gccagcgcccgcgaactcgccgcggatgtgtcgaaacgggttcgggccggcgatctcgca
cgcgccgaccagcatcaggcggatggagcggtggcgactgccgaagcgtcgctcgccgaa
gcccgcggcgcgctcgcgggtgcggaacagcaattgcgcgccctgactggcatgacacct
gcgcttgccgcggaaggactctccgtggccgaagccgagcccgccccaggcggcaactcc
gtccccctggaggcgcggcatccggccctcgcggaactgcgcgatcgggcggagcttgca
caacgcagcatgaccctcgccgggattcagggtcgcgccaatcccgagctttacctggcg
acgacgcgcgagcgcggcgcatccggcgaatcctggcaacagacagtgacgatcggggta
cgcattcccttcggatccgacacccgcaaccgcgcccgtgttgccaatgccagcgccgag
gcgatcgaagccgaaacccagctgaggctggaacgcgaacgcctgacggccgaagtggat
acggcgcgcgtccgcgtcgaatcggcgcgcaccctggtcgcctctgccgaacagcgcgcg
cacttggcccgcgagtcgcgcggcttcttcgagaaggcgttccgcctcggcgaaaccgat
ctgccgacccgcctgcgcatcgaactcgaagccgccgaagccgagcgccaggtggcgcgc
acccgcatcgaactggccgcggccgtgtccgcgctgcggcaggccatgggacttcttccc
gaatga

DBGET integrated database retrieval system