KEGG   Zoogloeaceae bacteirum Par-f-2: C3497_14285Help
Entry
C3497_14285       CDS       T05440                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
zpa  Zoogloeaceae bacteirum Par-f-2
Brite
KEGG Orthology (KO) [BR:zpa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    C3497_14285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AVZ80853
UniProt: A0A2S0R2T8
Position
complement(3016713..3017750)
Genome map
AA seq 345 aa AA seqDB search
MDAQFVLTVLAVLTVLAFDYTNGFHDAANVVATVIASRAMLPAQAVALVAVFEFLGPVLG
GTAVANTIGSFVDLNGLPVQLSLGVLLAGLLGAIGWNLLTWWWGVPSSSSHALVGGLAGA
VIAAAGPAHVVWGFGAWLDGGPLTGVAKVVLALLLSPLLGFAVGYLIHRLLGLLFRAARP
ALNRRLRGAQFITTAGLAFSHGANDAQKSMGILTLVLVLGGVIPAFEVPLWVMLACATAM
TLGILSGGWRIVRTLGFAVYKVRPLHALDSQLTSAAVILSASLVGAPVSTSHVVASSIMG
IGTAEHPRRVRWSKAGEIVATWAITIPASAVAGAALLLLLQPLFD
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
ttggatgcgcagttcgtgctcaccgtgctcgccgtgctcacggtgctggccttcgattac
accaacggttttcatgacgccgccaacgtggtggcgacggtgatcgcttccagggccatg
ctccctgcgcaggccgtggccctggtcgcagtgttcgagttcctcgggccagtgctgggc
ggcactgcggtggccaacacgatcggcagcttcgtggacttgaacggcttgccggtgcag
ttgtcgctgggggtgttgctggccggtctgttgggcgcgatcggctggaacctgctgacc
tggtggtggggggttccttcgtcgtcctcgcatgcgttggtaggcggactggccggcgcg
gtgattgccgccgccggcccggcgcacgtggtttggggctttggcgcctggctggatggc
gggccgcttaccggggtggccaaggtggtgctggcgctgctgctctcgccgctgctgggt
tttgcggtcggctacctgattcaccgcctgctcggtctgctgtttcgcgccgcgcgcccg
gcgctgaaccgccgtctgcgcggcgcgcagttcatcaccaccgcagggctggccttttcg
cacggcgccaatgacgcgcaaaagagtatgggcattctcaccttggtgctggtgctcggc
ggggtcatcccggccttcgaggtgccgctgtgggtgatgctggcctgcgccacggcgatg
accctggggattctttccggcggctggcgcatcgtgcgcacgctggggtttgcggtgtac
aaggtgcgtccgctgcacgcgctggactctcaactcacctcggcggcggtcatcctgtcg
gcctcgctggttggcgcgccggtatccaccagccacgtggtggccagctccatcatgggt
atcggcaccgcggagcatccgcgccgggtgcgctggtccaaggcgggcgaaatcgtcgcc
acctgggccatcaccatcccggcctcggctgtggccggcgccgcgctgttgctattgctg
caacccctgttcgattga

DBGET integrated database retrieval system