KEGG   Zymobacter palmae: ZBT109_1495Help
Entry
ZBT109_1495       CDS       T05646                                 

Definition
(GenBank) asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase A
  KO
K01426  amidase [EC:3.5.1.4]
Organism
zpl  Zymobacter palmae
Pathway
zpl00330  Arginine and proline metabolism
zpl00360  Phenylalanine metabolism
zpl00380  Tryptophan metabolism
zpl00627  Aminobenzoate degradation
zpl00643  Styrene degradation
zpl01100  Metabolic pathways
zpl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:zpl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    ZBT109_1495
   00360 Phenylalanine metabolism
    ZBT109_1495
   00380 Tryptophan metabolism
    ZBT109_1495
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    ZBT109_1495
   00643 Styrene degradation
    ZBT109_1495
Enzymes [BR:zpl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     ZBT109_1495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: BBG30255
UniProt: A0A348HF53
Position
complement(1623672..1624814)
Genome map
AA seq 380 aa AA seqDB search
MDKRVWAERIVSTARGDGPLAGLRLAVKDMFDIAGHVTGAGNPDWAATHAIPTRTAPCVE
RLCQAGALQVGKTQTDELAYSLNGANMHYGTPLNPAAPDRLPGGSSSGSAVAVASGDADI
GLGTDTGGSIRVPSSYCGLYGLRPSWGAIDISGTVPLAPRFDTVGFMCRSPSVLAQVGDV
LLPRSETTAAAEGVYWLAAEGLSVDLNVIGVRCAQMHVPLLGQHALTTAFMARASQAFRV
LQGRDIWRTHGDWITSTRPRFAPDVAARFQWAASLSEADGVQAQRQADSVIAQLWQWSGR
GRYMLALPSTPGAAPLLTLQGDALAHYREALMGMTALGGLWGAPVLAAPWLTDQQAPWGV
SLLAAPGNDRCLLNAACQLT
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggataagcgggtatgggctgagcgaatcgtatcgacagcgcgtggagacggacccttg
gccgggctgcgtttggccgtcaaggatatgttcgatatcgctggacatgtgaccggcgcg
ggtaaccctgactgggccgctacccatgctataccgacgcggacggccccctgtgtagag
cggctgtgtcaagcgggggcgctgcaggtgggcaagacccagaccgatgagctggcctat
agcctaaacggtgccaatatgcactacggtacccccttgaatcctgcagcgcccgaccga
ctgcccggtggttcatcgtcggggtcagccgttgccgtggccagcggtgatgctgacatt
gggttggggacggatacgggcggttcgattcgcgtgccgtccagctactgtggcctatac
ggtctacgccccagttggggagcaatcgacatcagcggtacggtgccgctggcgcctcgc
ttcgatacggtggggtttatgtgtcgctcaccgagcgtgttggcgcaagttggtgacgtg
ctactgccgcgtagcgaaacgaccgcggcagcagaaggggtctattggttggccgcggaa
ggtctttcggtcgatttgaatgtgatcggcgtgcgttgtgcgcagatgcacgtgccattg
ctggggcagcatgcattgaccacggcgtttatggcgcgggctagccaggcctttcgggtt
ctacagggacgtgatatatggcgcacgcacggtgactggatcacatctacccgtccacgc
ttcgctcccgatgttgcggctcgcttccagtgggcggctagcctaagcgaggcggatggc
gtacaggcgcagcggcaggccgacagcgtgatcgcccaactgtggcagtggagtggccgc
ggtcgctatatgctggccttgcccagtacgccgggggccgcgccgttgctaacgctacag
ggcgacgctctggcgcactatcgtgaagcgctgatggggatgaccgcgttgggtgggctc
tggggcgcgcccgtactggccgctccatggctgacggatcagcaggctccttggggggtg
tcgctgctggcggcccccggtaatgaccgctgcctgttgaatgccgcctgtcagttgacc
tga

DBGET integrated database retrieval system