KEGG   Zymobacter palmae: ZBT109_2012Help
Entry
ZBT109_2012       CDS       T05646                                 

Definition
(GenBank) threonine dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
zpl  Zymobacter palmae
Pathway
zpl00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:zpl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ZBT109_2012
Enzymes [BR:zpl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     ZBT109_2012
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     ZBT109_2012
    1.1.1.-  
     ZBT109_2012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Shikimate_DH F420_oxidored TrkA_N ApbA Sacchrp_dh_NADP Pyr_redox 2-Hacid_dh_C ADH_zinc_N_2 NAD_binding_3 AlaDh_PNT_C Pyr_redox_2 KR ThiF
Motif
Other DBs
NCBI-ProteinID: BBG30758
UniProt: A0A348HGK6
Position
complement(2215721..2216776)
Genome map
AA seq 351 aa AA seqDB search
MKALRWHARRDLRIDDIDSRAPGTGEVRINVAWCGICGTDLHEYNAGPVIIPTEAPHPLT
GETAPVVLGHELSGTIAEVGEGVTEWKVGDRVTVEPLLFNPDSPSSRQGDYHLCEDGGLI
GISGIGGGFAEEVTLSEKLLHRLPDEVSLEQGALVEPVAVAVHAVRSSAFKPGDRVAIFG
AGAIGLMLVETLKAAGAQDIYVVQRSEARRRKAEEMGAITIDPSAVDPVEKLIELTRGGV
DVAFEVTGASRMLQASLSCTRSHGQTVVVSVWEEPATVQPNVLLLKERNVMGVFAYRNVF
PTVISLMKRGFFKTEDFVTARIPLADAIEEGFERLNTDKTQIKVLVSPSLA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacgttggcatgctcgccgcgacctcagaattgatgacatcgatagccgt
gcgcctggcacaggcgaggtgcgcatcaatgtggcgtggtgtggcatctgtggtaccgac
ctgcatgaatacaatgcgggcccggttatcattccaacggaagcaccgcatccgctgacc
ggtgaaactgcgccggtcgtactgggccatgaactgtccggcaccatcgctgaagtgggc
gaaggtgtcacggaatggaaggtcggcgatcgcgtaacggtagagccgctgctgttcaac
cctgactctccttcctcccgtcagggcgactatcacctgtgcgaagatggtggtttgatt
ggcatctccggtattggcggcggtttcgctgaagaggtcacgctgtccgaaaaattgctg
caccgtttgccggatgaagtctcgctggagcagggcgcgttagttgagccggtcgcggtt
gccgttcatgccgtgcgtagtagtgcgttcaaaccgggcgatcgcgtggcgatctttggg
gctggtgcgatcggtttgatgctggtcgagaccctgaaagccgcgggcgctcaggatatc
tacgtcgtccagcgttctgaagcacgccgtcgcaaggcggaagaaatgggcgcgatcacg
atcgacccgtctgcggttgatccggtcgaaaaactgattgagctgacccgtggcggcgta
gacgtggcctttgaggtcacgggtgctagccgtatgttgcaggctagcctgtcctgcacg
cgtagccacggtcagaccgttgtggttagcgtatgggaagaacccgctaccgttcagcca
aacgtgctgctgctgaaagagcgtaacgtgatgggtgttttcgcttaccgcaatgtgttc
ccgaccgttatctcgctgatgaagcgcggcttcttcaaaacggaagatttcgtaacggcc
agaattccgctggcggatgccattgaagaagggttcgagcgccttaacacggataagacc
cagatcaaagtactggtctctccatctcttgcgtga

DBGET integrated database retrieval system