KEGG   Zymobacter palmae: ZBT109_2093Help
Entry
ZBT109_2093       CDS       T05646                                 

Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
zpl  Zymobacter palmae
Pathway
zpl00561  Glycerolipid metabolism
zpl00640  Propanoate metabolism
zpl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zpl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ZBT109_2093
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    ZBT109_2093
Enzymes [BR:zpl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     ZBT109_2093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 Peripla_BP_6 DHQ_synthase AIRC Peripla_BP_4
Motif
Other DBs
NCBI-ProteinID: BBG30837
UniProt: A0A348HGT5
Position
2309627..2310715
Genome map
AA seq 362 aa AA seqDB search
MNTQTLIIPATIIRGPSALDSVGNICRTLGRRALVIGGHRARAAVREKLEAQLAEHGITL
VGDEWFGGDSTRTQIDRLKALAETQDADVLIGVGGGKALDTVKATAAEAGLPLITIPTIA
ATCAAITPLTVTYTEEGLFLDLYNLPKAPDAVIIDSQLLATAPLRWLAAGLGDTLAKWYE
FRALGKSEEATAIAASSVASSRICYDMIRLYGGEACAGVREQRNTPALEQVLDAIFTFAG
LTSIMASGAHACAAHGIYAGFTACDKTRHFGHGLLVGFGNLCLLALEGRSDDEIIEAIHI
ARDCSVPLTLDEIEPTLTPEELDVIIAAALTSHDMGHMPFKVTADDLKSAFKRVAGLAAS
VS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgcaaaccctgattattcccgcgaccatcatccgtggccccagcgcactcgac
tctgtaggcaacatctgccgcacgctgggtcgtcgcgccctggtgatcggcgggcaccgc
gcacgcgctgccgttcgtgaaaaactcgaagcacaactggccgaacacggcatcacactg
gtcggcgatgaatggtttggcggcgacagcacgcgtacgcagatcgaccgcctcaaagcg
ctggctgaaacgcaggatgccgatgttctgatcggcgtcggcggcggcaaggccctcgat
accgtcaaggcgacggccgcggaagcagggttgccgctgatcaccatcccaaccatcgcg
gcaacctgtgcggccatcacgccactgacggtcacctataccgaagaagggttgtttctc
gacctctacaacctgccgaaagcaccggatgccgtcattatcgacagtcagttgctagca
acggcaccgctgcgctggctggccgctggcctaggtgacacgctggccaaatggtatgaa
ttccgtgcgctgggcaaaagcgaagaagcgacagccattgcggcatcatcggtcgccagc
agccgcatttgctacgacatgatccgcctgtacggcggcgaagcctgtgcaggcgtacgc
gaacagcgcaatacgcccgcactcgaacaggtgctggacgccatctttacctttgctggc
ctgacctccattatggccagtggcgcgcatgcctgcgcagctcacggcatctacgcgggc
tttacggcctgcgataagacccgccacttcggccacggtctgctggtcggtttcggcaac
ctgtgcctgctggcactcgaaggccgcagcgatgatgaaatcatcgaagccatccatatc
gcacgcgactgctcggtaccgctgacacttgatgaaatcgagcctacgctgacaccggaa
gaactcgacgtcattattgcagccgccctgacctctcacgacatgggacatatgcccttc
aaggtcactgctgacgacctgaaaagcgctttcaaacgtgtggcaggactcgccgcgtcg
gtcagctga

DBGET integrated database retrieval system