KEGG   Zymobacter palmae: ZBT109_2271Help
Entry
ZBT109_2271       CDS       T05646                                 

Definition
(GenBank) predicted amidohydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
zpl  Zymobacter palmae
Brite
KEGG Orthology (KO) [BR:zpl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ZBT109_2271
Enzymes [BR:zpl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     ZBT109_2271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase UCR_Fe-S_N TAT_signal
Motif
Other DBs
NCBI-ProteinID: BBG31003
UniProt: A0A348HHA1
Position
2518430..2519368
Genome map
AA seq 312 aa AA seqDB search
MTVSPSRRRFLNTTLGVSAMALTATPFITQAGAATATTSSASSTADSSDMLTIALGQLAV
ADQWQDNAAQCSRLIQQAAQQGADLLIMPEAILAADIGDPECVRRSAQPLDGPFMQQMLK
ATLQVPLTVVFTLYVPADAQRVGNVQVALRQGRIVATYHKLHLYDAFTMQESQSVEPGKT
LPPIFDVAGMKVGMMTCYDLRFPEEAKSLALRGAELIVLPAAWVRGPNKECHWETLIAAR
ALDTTCFVAAVSECGPHTIGCSMVADPMGLVVARAGETPTLVTTRISRQRLAQARKALPV
LTNGRFKAPELA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtctcaccttctcgccgtcgctttctaaacactacgttaggcgtctcggcaatg
gcgttgaccgccacgcccttcatcacgcaagccggtgccgccacggctaccacttccagc
gcatcgtcgacagcagattcatcggacatgctcacgatcgcactgggccagctggccgtc
gccgatcagtggcaggacaatgcagcacagtgctctcgtcttatccagcaggcggcacag
caaggcgccgacctgctgatcatgccggaggcaatacttgccgctgacattggcgaccct
gaatgcgttcgacgttcggcccaaccgctggacggcccattcatgcagcagatgctaaaa
gccaccctacaagtaccgctaaccgtcgttttcaccctgtatgttcctgctgatgctcag
cgcgttggcaacgttcaggttgccctgcgacagggcaggatcgtagcgacgtaccacaag
ctgcatctttatgatgctttcaccatgcaggaatcacagagcgttgaaccgggcaagaca
ctgccacctatcttcgatgtcgcgggaatgaaggtgggaatgatgacatgctacgacctg
cgctttcctgaagaagcaaaatcgctggcgctgcgcggagccgaactgatcgtgctgccc
gccgcatgggtacgtggccccaacaaggagtgccactgggaaacgctgatcgcagctcgt
gcactcgacacgacctgcttcgtagccgccgtcagcgaatgcggcccacatacgattggc
tgcagcatggtggctgatccgatgggactggtcgttgcccgcgcgggtgaaacgccgaca
ctggtcaccacacgcatttcgcgccagcgcctcgctcaggccagaaaggcacttcccgtg
ctgaccaacgggcgcttcaaggcccccgagctggcatga

DBGET integrated database retrieval system