KEGG   Zunongwangia profunda: ZPR_0027Help
Entry
ZPR_0027          CDS       T01216                                 

Definition
(GenBank) glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
zpr  Zunongwangia profunda
Pathway
zpr00860  Porphyrin and chlorophyll metabolism
zpr00970  Aminoacyl-tRNA biosynthesis
zpr01100  Metabolic pathways
zpr01110  Biosynthesis of secondary metabolites
zpr01120  Microbial metabolism in diverse environments
Module
zpr_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
zpr_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:zpr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ZPR_0027
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ZPR_0027
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:zpr01007]
    ZPR_0027
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:zpr03016]
    ZPR_0027
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:zpr02048]
    ZPR_0027
Enzymes [BR:zpr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     ZPR_0027
Amino acid related enzymes [BR:zpr01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   ZPR_0027
Transfer RNA biogenesis [BR:zpr03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ZPR_0027
 Prokaryotic Type
   Other AARSs
    ZPR_0027
Prokaryotic defense system [BR:zpr02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    ZPR_0027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: ADF50390
UniProt: D5BBF6
Position
complement(26931..28448)
Genome map
AA seq 505 aa AA seqDB search
MSSNVRVRFAPSPTGPLHIGGVRTALYNYLFAKKHGGDFILRIEDTDQNRYVEGAEKYII
DSLNWCNIPYDEGPGKEKDCGPYRQSERKSLYKAYADKLIESGNAYYAFDSAEDLDKHRK
SHEAEGKTFIYNWHNREKLDNSLALPEEQVKKRIENGEHYVVRFKSPKDEILKISDEIRG
NMEIDTNILDDKVLYKSDGMPTYHLANIVDDHLMKISHVIRGEEWLPSLALHFMLYRAFG
WAAPKFAHLPLILKPQGKGKLSKRDGDKLGFPVFPLQWKDPESGEISAGYREDGYFPEAV
TNMLAFLGWNPGTEQEFFSLEELTKAFDLKRVHKGGAKFDPEKTKWFQQHYLQEADNNFI
AEQFLDILKKKEIEATKEYTKHVIELVKERAIFIEDIWEQGFYFFTSPTSYYPKNTKKAW
EEDTHLLMTELIEVIQGIENFKANIIAEKVKSWITAKEIGFGKIMQPYRISLVGSLQGAD
LFEISEAIGKHETIARIKKANETLR
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctaacgtacgcgtaagatttgcacctagcccaacagggcctttacacattggc
ggagtaagaacagctttatacaattacttgtttgcgaaaaaacatggcggtgactttata
ttaagaattgaagataccgatcaaaaccgttatgttgaaggcgctgaaaaatatattatt
gattctttaaactggtgtaacatcccatatgacgaaggaccaggaaaagaaaaagattgc
ggcccttatcgccaaagtgagcgtaaaagtctttataaagcctatgcagataaattaatt
gaaagcggtaatgcttattatgcttttgatagcgcagaggatttagataagcatagaaaa
tctcacgaagcagaaggtaaaacttttatttacaactggcataatcgtgaaaagcttgat
aattctttagcactaccggaagagcaagttaaaaagagaattgaaaatggcgaacattac
gtagtgcgctttaaatctcccaaagatgaaatcttaaaaatctcagatgaaattagggga
aatatggagatcgatacgaatatattagacgataaggtactatataaaagtgacggcatg
ccaacttatcatttagccaatatcgtagatgatcatttaatgaaaatctctcatgtaatt
cgcggtgaagaatggttaccttcattagctctacactttatgctttaccgtgcctttgga
tgggctgctccaaaatttgcgcatttaccacttattctaaaacctcagggtaaaggcaaa
ttgagtaagcgtgatggtgacaaattaggtttcccagtatttcctttgcaatggaaagat
ccagagagcggagaaatttctgctggatatcgcgaagatggttatttcccggaagccgtt
accaacatgttagctttcttgggatggaacccgggaaccgaacaggaattcttttcacta
gaagaattgacaaaagcttttgatcttaaacgtgttcataaaggcggcgcaaaatttgat
cctgagaaaaccaaatggtttcaacaacactatttacaggaagccgataataattttata
gctgaacaatttttagacattttaaaaaagaaagaaattgaagctactaaagaatatact
aaacatgttatagaattggtaaaagaaagggccatttttatcgaagacatttgggagcag
ggattttattttttcacctcccctacttcatactatcctaaaaataccaaaaaagcctgg
gaagaagatacccatcttttaatgactgaacttatagaagtgatacagggcattgaaaat
tttaaggccaatataattgctgaaaaagtaaaatcctggattaccgcaaaagaaataggt
tttggtaaaataatgcaaccttatcgaatttctttagtaggatccttacagggagcagat
ctttttgaaatatctgaagctattggaaaacacgaaacgatagcacgaattaaaaaagct
aatgaaacgcttcgctaa

DBGET integrated database retrieval system