KEGG   Zunongwangia profunda: ZPR_0157
Entry
ZPR_0157          CDS       T01216                                 

Definition
(GenBank) bifunctional pyrazinamidase/nicotinamidase
  KO
K08281  nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
zpr  Zunongwangia profunda
Pathway
zpr00760  Nicotinate and nicotinamide metabolism
zpr01100  Metabolic pathways
zpr01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:zpr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ZPR_0157
Enzymes [BR:zpr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     ZPR_0157
    3.5.1.-  
     ZPR_0157
SSDB
Motif
Pfam: Isochorismatase
Other DBs
NCBI-ProteinID: ADF50518
UniProt: D5BCK5
Position
150374..150976
AA seq 200 aa
MKALLLIDVQNDFMPGGALAVPDGDKIVPIINKIQHQFDLVLATQDWHPEGHASFASTHH
KNLYEVIDLNGIDQVMWPDHCVQGSRGADFHPKLKLNKIEAIFRKGTDPEIDSYSGFYDN
AHLKSTGLSGYLKEKGINELYFAGLAGDFCVAFSVKDALAEGFAAFLIEDATRAIDAAGF
EKAKAEIVEKGGKILYADEV
NT seq 603 nt   +upstreamnt  +downstreamnt
atgaaggctttacttcttatagacgtacaaaacgattttatgcctggcggcgccttagcc
gttcccgatggcgataagattgtaccaataattaataaaattcagcatcaattcgattta
gtgcttgctacccaggactggcatccggagggtcatgcaagttttgccagcacccatcat
aaaaacctttacgaggtaattgatttaaacggaatcgatcaggtcatgtggccggatcat
tgtgtgcagggtagtaggggtgccgattttcatcctaagctgaaattgaataaaatcgaa
gcgatttttagaaaaggtaccgatcctgaaattgatagttacagtgggttttatgataat
gctcatttaaaatctactggtttaagtggctatttaaaagaaaaaggaataaacgagcta
tattttgccggtctggccggtgatttttgtgtagcttttagtgttaaggatgctttagct
gaaggttttgcagcttttttaattgaagatgccacacgcgctatagatgctgcaggtttt
gaaaaagcaaaagctgaaattgttgaaaaaggagggaagatattatatgcagatgaggta
tag

DBGET integrated database retrieval system