KEGG   Zunongwangia profunda: ZPR_1384Help
Entry
ZPR_1384          CDS       T01216                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
zpr  Zunongwangia profunda
Pathway
zpr00040  Pentose and glucuronate interconversions
zpr00053  Ascorbate and aldarate metabolism
zpr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zpr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ZPR_1384
   00053 Ascorbate and aldarate metabolism
    ZPR_1384
Enzymes [BR:zpr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     ZPR_1384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF2267 DUF1944 DUF2229
Motif
Other DBs
NCBI-ProteinID: ADF51720
UniProt: D5BK40
Position
complement(1496846..1498414)
Genome map
AA seq 522 aa AA seqDB search
MITGKNYIGEELSSKGEVTFKTFDPKENKETAAIFYEATPDEVDAAVEKAAAAFKVYKQK
SDADKAEFLEAIAEELEANAEALKQIYRVESGLPEGRSNGEFARTAGQLRAFAEMLKEGS
WVEAIISNPEGKPDIRRMQVPFGPVAVFGASNFPFAFSTAGGDTASALASGSPVVVKSHP
LHAGTGELVSEAIIKAAKRTGMPDGVFSNLNSKGIEVGEWLVKHPKIKAVGFTGSYKAGT
ALCKLAADRAEPIPVYAEMGSINPVLALPSALEEKADFWAEQYAGSITAGCGQFCTNPGL
ILGIESTDLNNFVEKLGKNLSNLAPSVMLSPGIQHQYEASKTEVLEQEGYSEVSKYNGDL
QPNFGRQQVITVSGANFLQNKNFHKEVFGPFSVVVKCKDKTELGEVLEQLEGQLTGTVLN
SEEKELSEFATIIDTLTDTVGRIIYNSVPTGVEVCAAMTHGGPFPATSNAKFTSVGLTAV
QRWVRPVSFQDWPQALLPQALKDENSLGILRNINNKYTTDSL
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgattacaggaaaaaattatattggtgaggagctttccagtaaaggtgaagtaaccttt
aaaacttttgatccaaaagaaaataaagaaacggccgctattttttatgaagctacaccc
gatgaggttgatgctgctgtagaaaaagcggctgccgcttttaaagtgtataagcaaaaa
tctgatgctgataaagccgaatttttagaggcaattgctgaagaacttgaagcaaatgct
gaagctttaaaacaaatttacagagtagaatccggtttgccagaaggacgttctaatggc
gaattcgcacgtacagccggacagttaagagcttttgcagagatgcttaaagaaggtagt
tgggtagaggcgataattagcaatcccgaaggaaaacctgatattcgaagaatgcaggta
ccatttggacccgttgcggtttttggagcgagtaatttcccctttgcgttttctacagca
ggaggagataccgctagcgcattagcatcaggttctccggttgtcgtaaaatcacatccc
ttacatgcaggtacgggagaattggtttctgaagcaattataaaagcggctaagagaaca
ggaatgccagatggtgtgttttctaacttaaatagcaaagggattgaagttggagaatgg
cttgtaaaacatccaaaaattaaagcggttggatttactggaagttataaagcgggtact
gcactttgtaaattagctgcagatcgtgctgaacctataccggtgtatgcagaaatggga
agtattaatcccgttttggctttaccttcagccttagaagaaaaagctgatttttgggct
gagcaatatgcaggttctataaccgctggatgtggccagttttgtacaaatccaggatta
attttgggaatagagagtacagacttaaataattttgttgaaaaattaggaaagaattta
tcgaatcttgcaccttcagtgatgcttagtcccggaatccaacatcaatatgaggcttca
aaaacggaagttttagagcaagaaggctattctgaagttagcaagtataatggcgatctt
cagccaaattttggcagacagcaagtgatcacggtttctggtgcaaatttccttcagaat
aaaaacttccataaagaagtattcggtccattttcagtagtggtaaaatgtaaagataaa
accgagttaggtgaagtgcttgagcaactagaagggcaattaaccggtacagtattaaac
tccgaagaaaaagaactaagtgaatttgcgacgattatcgatactttaaccgatacggta
ggcagaattatttacaacagtgtgccaacaggggtagaggtttgtgcggcgatgacgcat
ggcggaccattcccggcaacctcgaatgccaaattcacttcagtaggattaacagcggta
caacgatgggtacgcccggtttcttttcaggactggcctcaggcattgctaccacaggcc
ttaaaagatgaaaattctttaggaattttacgtaatatcaataataaatacacaacagat
agcttatag

DBGET integrated database retrieval system