KEGG   Zunongwangia profunda: ZPR_1645Help
Entry
ZPR_1645          CDS       T01216                                 

Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
zpr  Zunongwangia profunda
Pathway
zpr00020  Citrate cycle (TCA cycle)
zpr00640  Propanoate metabolism
zpr00660  C5-Branched dibasic acid metabolism
zpr01100  Metabolic pathways
zpr01110  Biosynthesis of secondary metabolites
zpr01120  Microbial metabolism in diverse environments
zpr01130  Biosynthesis of antibiotics
zpr01200  Carbon metabolism
Module
zpr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
zpr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:zpr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ZPR_1645
   00640 Propanoate metabolism
    ZPR_1645
   00660 C5-Branched dibasic acid metabolism
    ZPR_1645
Enzymes [BR:zpr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ZPR_1645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 Succ_CoA_lig
Motif
Other DBs
NCBI-ProteinID: ADF51980
UniProt: D5BLL4
Position
1773944..1775137
Genome map
AA seq 397 aa AA seqDB search
MNIHEYQGKEILGSFGVRTQRGIVAQTAEEAVKAAKELTEQTGTGWHVIKAQVHAGGRGK
GGGVKLAKNLKEVEQIAGEIIGMNLVTPQTSAEGKKVHQVYVAEDVYYPGDSEPEEYYMS
VLLNRATGRNMIMYSTEGGMDIETVAEETPHLIFTEEIDPATGLLPFQARKIAFNLGLSG
TAFKEMTKFVTSLYTAFDKSDSSLFEINPVLKTSDDKILAVDAKVTLDDNALFRHKDYAE
MRDKREENPTEVEAKEVGLNYVDLDGNVGCMVNGAGLAMATMDLIKQAGGEPANFLDVGG
TADAKRVEEAFRLILKDEKVEAILVNIFGGIVRCDRVAQGIVDAYKNMGDAIKVPIIVRL
QGTNADVAKKLIDESGLAVSSAVQFKEAADKVQAVLS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaacatacacgaatatcaaggaaaagagattctaggtagctttggagtacgtactcaa
agagggatcgtagcccaaactgcagaagaagctgtaaaagccgcaaaagaactaacagag
caaaccgggaccggatggcacgtaatcaaagcacaggttcatgcaggtggtcgtggtaaa
ggaggcggcgttaagcttgcaaaaaaccttaaagaagtagagcagattgccggagaaatc
atagggatgaatttggtaactcctcaaacctctgcggaaggtaaaaaagtgcaccaggta
tacgtagcagaagatgtttattacccaggagatagcgaaccagaagaatattatatgtcg
gttttattaaaccgtgcaacaggtcgcaatatgattatgtattctacggaaggtggaatg
gatattgaaaccgttgcggaagaaacaccgcatttaatttttaccgaagagattgatcct
gccacaggacttttacctttccaggccaggaaaattgcctttaatctaggtcttagtgga
acagcttttaaagaaatgacaaaatttgtcacctctctttatactgcattcgataaatct
gattcctctttattcgagattaacccggtacttaaaacaagtgacgacaagattttagca
gtagatgctaaagttactttagatgacaatgcacttttccgtcacaaagactacgcagag
atgcgtgataagcgtgaagaaaaccctactgaagtagaagcaaaggaagtaggtcttaac
tatgtggatctagacggtaacgtaggttgtatggttaatggtgctggtcttgctatggca
accatggatcttattaaacaagctggtggtgagcctgcaaacttccttgatgtaggaggt
actgcagatgctaaacgtgtagaagaagcttttagattaattttaaaagatgaaaaagta
gaagccattcttgtgaatatttttggaggtatcgtacgttgtgaccgtgtggcacaaggt
attgtagatgcttataaaaatatgggagatgcaattaaggttcctattattgtaagatta
caaggtaccaatgccgatgtcgcgaagaaactgatcgacgaaagtggtctggcagtttcc
agtgccgtacaatttaaagaagcagcagataaagtacaggctgtgctttcttaa

DBGET integrated database retrieval system