KEGG   Zunongwangia profunda: ZPR_2819Help
Entry
ZPR_2819          CDS       T01216                                 

Definition
(GenBank) beta-phosphoglucomutase
  KO
K01838  beta-phosphoglucomutase [EC:5.4.2.6]
Organism
zpr  Zunongwangia profunda
Pathway
zpr00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:zpr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ZPR_2819
Enzymes [BR:zpr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.6  beta-phosphoglucomutase
     ZPR_2819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: ADF53139
UniProt: D5BG26
Position
complement(3035684..3036340)
Genome map
AA seq 218 aa AA seqDB search
MNQKAIIFDLDGVIVDTAKFHFLAWKKLANDLGFDFTKEQNEELKGVSRVDSLKKILNWG
NRELTEDEFNRQMQLKNENYLSYVNKMDKGEVLPGVQKVLDYLNENNTPYALGSASKNAR
HILEKIDLKDGFNAIVDGTDVSKAKPDPEVFLIAAEKLNVAPQDCIVFEDSVAGIQAANK
GQMTSIGIGDKKTLHEADYIFSDFTEISIEFLKNLLQK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaaaagctatcatattcgatcttgatggtgtaatcgtagatacagcaaaattt
cattttctggcctggaaaaaactggcaaatgatttaggtttcgattttaccaaagaacag
aatgaagaattaaaaggagtaagcagggtagattcgcttaaaaaaatactgaactgggga
aatagagagcttaccgaagatgagtttaatcgacaaatgcaacttaaaaatgaaaactat
ctatcttatgtaaataagatggataaaggtgaagtgcttccaggagttcaaaaagtactc
gattatttaaatgaaaataacactccctacgcattaggatcggccagtaaaaatgctcgt
catattttagaaaaaatcgatttgaaagatggttttaatgccatcgtggatggtacggat
gtaagcaaagcgaaaccagatccagaagtttttcttatcgctgctgaaaagctgaatgtt
gctccgcaagattgtattgtattcgaagattctgtagccgggattcaggcggcaaataag
ggacaaatgaccagtatcgggattggtgataaaaaaacactacatgaagccgattatatc
ttcagtgattttactgaaatctcgatcgaatttttaaaaaatctactccaaaaataa

DBGET integrated database retrieval system