KEGG   Zunongwangia profunda: ZPR_2825Help
Entry
ZPR_2825          CDS       T01216                                 

Definition
(GenBank) alpha-amylase precursor, GH13 family protein
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
zpr  Zunongwangia profunda
Pathway
zpr00500  Starch and sucrose metabolism
zpr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zpr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ZPR_2825
Enzymes [BR:zpr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ZPR_2825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939 DUF4999
Motif
Other DBs
NCBI-ProteinID: ADF53145
UniProt: D5BG32
Position
3044908..3046353
Genome map
AA seq 481 aa AA seqDB search
MKKTFKNKPIFYLLILVIFFSCSSDDDTTTVDPDDDSSIGQPEPVSALNLAEYDNGSGVM
MQAFYWDVEPRFEWWNTISDKLGSWADAGVNRIWIPPASKGQSGGYSMGYDPSDYYDFGE
YDQHGTIPTRFGTREDLEQMISVAHDNDIEVIADMVLNHNSGGGLEYNPYREKETYTLFD
ETHGNASGMFNRNYEDFYPNSVSNYDPGSLFYQETNLDHHRERVQNWLWKDENSVAKYYK
NVMGFDGWRFDYVLGFEDFVIKDWLEEVGGFSVSELWDGNPGVLRNHIEATGSGVFDFAA
FYVMEQAFDRNHDLKGLTNDQVWQTNPEKAVTFTANHDTEKDANEDNIIAPENKLKAYAF
IMTHPGYPTVFYLDYENPEFQEQLNKLIRIHNSLATGSLEIIYADNDEYIMQRSGNSENP
GLILYMNISASAKRRTITTSWDSYILMDYSENSNYHPKVSEDGEVTIEAPANSYAIWSIT
E
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacatttaaaaataagccaattttctatttactgattttggttattttcttt
agttgttcttcagatgatgatactacaacagtagatccggatgatgatagtagtatagga
caaccagaacctgtttccgcattaaacctggcagaatatgataatggtagcggggtaatg
atgcaggctttttactgggatgtagaaccacgatttgaatggtggaataccatatctgat
aaattaggctcctgggccgatgcgggggtaaaccgtatctggattccacctgccagcaag
gggcaatctggtggttattctatgggttacgatccttcagactattatgactttggagaa
tacgatcagcatggcaccatccctactcgatttggaactcgcgaagacctggaacaaatg
attagcgtagcacacgataatgatattgaagtaatcgccgatatggtattaaatcataac
tctggcggcggtctggaatacaatccctatcgcgaaaaagaaacttataccctattcgac
gaaactcatgggaatgcctcaggaatgtttaacagaaattacgaggatttttatcctaac
agtgtaagcaattacgatccgggaagtttattttaccaggaaaccaatttagatcatcat
agggagcgcgttcaaaactggttatggaaagatgaaaattctgttgccaaatattataaa
aatgttatgggctttgatggctggcgttttgattatgtactgggctttgaagattttgta
attaaagactggttggaagaagttggcggattctctgtaagtgaactttgggacggcaat
cctggcgtattaagaaatcatattgaagctaccggaagtggggtgtttgattttgctgct
ttctacgttatggaacaggcttttgatagaaaccatgatctaaaaggtcttaccaatgat
caggtttggcaaacaaacccagaaaaggcagtaacttttacagccaatcatgatactgaa
aaagatgctaacgaggataatatcatagctcccgaaaataagcttaaagcatatgctttt
attatgacgcatcctggttatcctaccgtattttacctggattatgaaaatcctgaattc
caggagcagttaaacaaattaatacgtattcataatagtttagccaccggctctttagag
ataatctatgccgataatgacgaatacatcatgcaaagaagtggaaactcagaaaatcct
ggtcttattctttatatgaacatttcagcaagtgcaaaaagaagaacaataaccacaagt
tgggattcttacattttaatggactattctgaaaattcaaattaccatccaaaagtaagt
gaagatggggaagtgactattgaagctcctgcaaattcttatgcgatctggtcgatcaca
gaataa

DBGET integrated database retrieval system