KEGG   Zunongwangia profunda: ZPR_2827Help
Entry
ZPR_2827          CDS       T01216                                 

Definition
(GenBank) hypothetical protein
Organism
zpr  Zunongwangia profunda
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADF53147
UniProt: D5BG34
Position
3049535..3049669
Genome map
AA seq 44 aa AA seqDB search
MNINYFCVLFYFVIIGVYSQESRKNWNEGNITWDDGLPGTRNFF
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcaactatttttgtgtgctcttctatttcgtaattataggagtatacagtcag
gaatccagaaaaaactggaatgaaggaaatataacctgggatgacggacttccgggaacg
cgaaatttcttttga

DBGET integrated database retrieval system