KEGG   Zunongwangia profunda: ZPR_2828Help
Entry
ZPR_2828          CDS       T01216                                 

Definition
(GenBank) hypothetical protein
Organism
zpr  Zunongwangia profunda
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADF53148
UniProt: D5BG35
Position
3049749..3050024
Genome map
AA seq 91 aa AA seqDB search
MQSFCYTDTQLSWIKPGFKAPQNLQYNQVIFNIAELYRRKLQYDLDRLGSCFSVETAFKH
QYEALNNEVEIFQSQSLSGRGLKLYRNGPPI
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaagtttttgctacaccgatacgcaactttcgtggataaaaccgggatttaaagcg
cctcaaaatctgcaatacaatcaggtaatttttaatattgcagaattataccgaagaaaa
ttacaatacgatctggatcgccttggttcttgtttttcagtggaaactgcttttaaacat
caatatgaggccctaaataatgaagtagaaattttccaaagtcaaagccttagtggaagg
ggtttaaaattgtataggaatggaccgccaatatag

DBGET integrated database retrieval system