KEGG   Zunongwangia profunda: ZPR_2834Help
Entry
ZPR_2834          CDS       T01216                                 

Definition
(GenBank) galactose-1-phosphate uridylyltransferase
  KO
K00965  UDPglucose--hexose-1-phosphate uridylyltransferase [EC:2.7.7.12]
Organism
zpr  Zunongwangia profunda
Pathway
zpr00052  Galactose metabolism
zpr00520  Amino sugar and nucleotide sugar metabolism
zpr01100  Metabolic pathways
Module
zpr_M00554  Nucleotide sugar biosynthesis, galactose => UDP-galactose
zpr_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:zpr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    ZPR_2834
   00520 Amino sugar and nucleotide sugar metabolism
    ZPR_2834
Enzymes [BR:zpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.12  UDP-glucose---hexose-1-phosphate uridylyltransferase
     ZPR_2834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GalP_UDP_transf GalP_UDP_tr_C HIT DUF4921 DUF4931
Motif
Other DBs
NCBI-ProteinID: ADF53154
UniProt: D5BG41
Position
3054631..3055671
Genome map
AA seq 346 aa AA seqDB search
MSHDINSIPHRRYNILTGEWILCSPHRTKRPWQGKTEKDTTPKKETYDPSCYLCPGNTRS
TGDKNPDYKEPYTFINDFSALLIDSPVATQENGLMKAETEIGICKVVCFSPDHSLTLPLM
EEEDITKVVKTWKKEYDELGSQENINYVQIFENKGAIMGCSNPHPHGQIWSQMSIPTEIE
KKSKHFKEYWDKNQSSLLGDYLKQELEAKERIIVENEHFVALVPYWAVWPYEIMIAPKKH
QQHIGQLSEDEEKAFAEILKKLTIKYDNLFETSFPYSSGIHQIPTDGAEYPEWHWHMSFY
PPLLRSATVKKFMVGYEMFAGPQRDITAEQAAKTLQNLSDIHYLKQ
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgagtcacgacattaattcgatccctcatagaagatataatattttaaccggcgaatgg
attctttgttctccacatcgtaccaaacgaccatggcagggaaaaaccgaaaaggatact
acgcctaaaaaggaaacctacgatcccagttgctatctatgcccgggaaataccagaagc
accggcgataaaaatccagattataaagaaccatatacttttataaatgacttctctgcc
cttctaatcgatagtcctgtggctactcaggaaaatgggctgatgaaggctgaaacagaa
attggaatctgtaaagtggtttgcttttcaccagatcactcccttacccttcctttaatg
gaagaagaagacattactaaagtggtaaaaacctggaaaaaggaatatgacgagttagga
agtcaggaaaatattaattatgtgcagatctttgaaaacaaaggtgccattatgggctgt
agtaatccgcatccacatgggcaaatctggtcacaaatgtctattccaaccgaaattgaa
aaaaaatcaaagcattttaaagaatactgggataagaatcaaagcagtttacttggtgat
tatttaaaacaggaactggaagctaaagagcgaattattgtagaaaatgagcattttgtt
gcgcttgttccttattgggcggtttggccatatgagattatgattgcgccaaagaaacat
cagcagcatattgggcagttaagtgaggacgaagaaaaagcctttgctgaaattcttaaa
aaactgactataaaatatgacaacctttttgaaacatcgttcccctattcaagcggaatt
catcaaataccaaccgatggcgctgaatatcccgaatggcattggcacatgagtttttac
ccgccgctattacgttcagctacagtgaaaaaatttatggtaggttacgaaatgtttgcc
ggcccacaacgggacatcactgcagagcaggctgcaaaaacattacaaaatctaagtgac
attcattatttaaagcaataa

DBGET integrated database retrieval system