KEGG   Zunongwangia profunda: ZPR_2835Help
Entry
ZPR_2835          CDS       T01216                                 

Definition
(GenBank) sodium-glucose/galactose cotransporter
  KO
K03307  solute:Na+ symporter, SSS family
Organism
zpr  Zunongwangia profunda
Brite
KEGG Orthology (KO) [BR:zpr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    ZPR_2835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SSF
Motif
Other DBs
NCBI-ProteinID: ADF53155
UniProt: D5BG42
Position
complement(3055771..3057435)
Genome map
AA seq 554 aa AA seqDB search
MEFELLDVIVFVAYALLIIGVGLWVSRGKGDTSEDYFLASKSLPWWAIGASLIAANISAE
QFIGMSGSGFALGLAIASYEWMAAITLIVVGKFFLPIFIEKKLYTIPEFIEVRYSKNLKT
ILAIFWICLFIFVNLTSVLYLGATALDTIIGSGDGAIFMECIIGLALFAAAYSLYGGLSA
VAWTDVVQVVLLVIGGLITTYIALEHVSSDGNIFTGMAEVYEQVPEKFSMILDKGEIITP
NGKDAWWDLPGIAVLVGGLWVANLYYWGFNQYIIQRTLAAKSLKESQRGIVLAGFLKILI
PLITVIPGIIAFVMNSDASGMINEGVTSASFFGENGRIINDNAAPWLIKEFVPAGLKGLV
LAALAAAIVSSLASMLNSTATIFTMDIYKPFFQEKAGTSEKGLVNVGRVTASIALVIAII
LAPQLKSLGQVFQYIQEYTGVVSPGILAVFMLGLFWRKTTNNAAIWGVLVSIPIALYFKV
GPNGWSDSPFFITWPFMHQMMATWILTMLIMIIISYLETGGKIQEKSITLSRNLFKTGPI
FNIGSFVIILIVAM
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggaatttgaattattagacgtgatagtattcgttgcctatgcgttgcttataatcggg
gtaggattatgggtttctcgtgggaaaggagatacttcagaggattatttcctggccagt
aaatctttgccatggtgggcgataggtgcttcactaattgcagcaaatatttctgcagag
caatttatcgggatgtctggttctggttttgcgctaggtttggctatcgcctcttacgaa
tggatggctgccattactttaattgtagtaggtaaatttttcttaccgatttttattgaa
aagaaactttataccattccagaatttattgaggttcgttacagtaaaaacctgaaaacg
atcttggctattttctggatctgtttatttattttcgttaatcttacttctgtactttac
ttaggagctacggcgctagatacgattattggtagcggtgatggcgcaatttttatggaa
tgtattattgggcttgctttgtttgctgcagcttactctttgtatggaggtttatcggca
gtggcatggacagatgtggtacaggtggtacttttggttattggggggctaatcaccaca
tatatcgctttagaacacgtttctagtgatggaaatatctttaccggtatggctgaagtt
tacgagcaggtaccagagaaattctctatgatccttgataaaggagaaatcattacacca
aatggtaaggatgcatggtgggatttaccgggaatcgctgttttagttggtggtctttgg
gtagcaaacctttattactggggctttaaccaatatattattcaaagaacccttgcagct
aaaagtttaaaagaatctcaacgcgggatcgtacttgcaggatttttaaagatattaatt
ccacttattaccgtaattccgggtattatcgcttttgtgatgaatagtgatgccagtggt
atgattaacgaaggggtaaccagtgcttctttctttggagaaaacggcagaattatcaat
gataatgctgcgccatggttaattaaggaatttgtgcctgcgggtcttaaaggacttgtt
ttagcagcacttgcggcagcgattgtatcgtcattagcttctatgcttaactctaccgct
acgatctttaccatggatatctataagccattcttccaggaaaaagcgggaacttcagaa
aaaggactggtaaatgtaggtagggttactgcttctatcgctttggttattgccattatt
ttagcacctcaactaaaaagtttaggacaggttttccaatatattcaggaatataccggg
gttgttagcccggggatcttagcggtatttatgctaggtttattctggagaaaaacaacc
aataatgcagcgatctggggagtactggtttcgattccgattgcattgtactttaaagta
gggccaaacggatggagcgattctcccttctttattacctggccatttatgcaccagatg
atggccacctggattttaaccatgcttatcatgataattatcagttatcttgaaaccgga
ggcaaaattcaggagaaatcaattacgcttagtagaaatttatttaaaacaggacctatt
tttaatatcggtagttttgtgatcattttgatcgttgccatgtga

DBGET integrated database retrieval system