KEGG   Zunongwangia profunda: ZPR_2838Help
Entry
ZPR_2838          CDS       T01216                                 

Definition
(GenBank) carboxylesterase
  KO
K06978  uncharacterized protein
Organism
zpr  Zunongwangia profunda
Brite
KEGG Orthology (KO) [BR:zpr00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    ZPR_2838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S15 PepX_C Peptidase_S9 DUF684
Motif
Other DBs
NCBI-ProteinID: ADF53158
UniProt: D5BG45
Position
complement(3060485..3062338)
Genome map
AA seq 617 aa AA seqDB search
MKLHQRSLLYTLLLFVVFQVAAQSGNDYNVKDHYTKTEVDIPMRDGTKLHTTIYTPKDTS
KKYPIIMQRTPYSSRPYGEGQMRSMIGPNQYLMQQGNIIVYQDVRGRWMSEGTYDNMRAY
IPNKKGEQFDEASDTYDTIDWLVKNVDNNNGNVGMWGISYPGFYSVYSLIDSHEALKAVS
PQAGISDFFFDDFHHNGAYLLSYWRATALFGYQKDAPTTESWYELPELGTQDQYQFFLDH
TPLSTLDEYYKEDNEFWQQLKDHPNYDEFWQSRGIIQHLDDVKPAVMIVGGLFDAEDLYG
PFNEYRKIEKSSNTYNILVYGPWSHGDWARESGRQSVGNVYFGDSLSTRFQQDYETKFFN
HFLKQNGKGSLDLAEAHIYDTGKREWTDYGQWPPKNTVTKTFYLGDDQELTTQPTDTKQE
FVSDPAKPVSYNDEIKTVFTPREYMTGDQRFAARRPDVLVYETEVLDEDLSVVGEIEAML
KVATTGSAADWVVKVIDVYPPDAENYPETMDHLKMSNYHMMVRSEVMRGRFRNDFSKPEP
FEPNKKTDVNITLQGVNHTFKKGHKMQIQIQSTWFPLIDLNPQIYVDNIFKAEKDDFQKQ
THTVFGDSAIKFSVLKK
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacaccagcgatcattactttatacgttattactctttgtagtatttcaggtt
gctgctcaatcgggcaatgattacaacgtaaaagatcattacaccaaaactgaagtggat
attcccatgcgggatggtactaaactgcacactacaatttatactcctaaggatacctca
aaaaagtatccaattattatgcaaagaacgccttatagctccagaccttatggagaagga
caaatgcgttctatgattggtcctaaccagtacctgatgcaacagggaaatattatcgtg
tatcaggatgtacgcgggcgttggatgagtgaaggaacgtatgataacatgcgtgcctat
attcccaataaaaaaggagaacaatttgatgaagccagcgatacttatgatactatcgat
tggttggtaaaaaatgtagataacaataatggaaacgttggaatgtggggaatttcttac
ccaggattctattcagtttattctttaatagattctcacgaagctctaaaagcggtttca
ccacaagcgggaatttcagatttctttttcgatgattttcatcataatggtgcttatctc
ttaagctactggagggcaactgcactttttggatatcaaaaggatgcccctacaacagag
agttggtatgagttaccagaacttggcactcaggatcagtatcaattcttcttagatcat
acaccactaagtactttagatgaatattataaagaagataacgaattctggcaacagtta
aaagaccatcctaattatgacgaattttggcaatccagagggattatccaacatttagat
gatgtaaaacctgcggtgatgattgttggtggattatttgatgctgaagatttatatgga
ccatttaatgagtacaggaaaattgaaaaatccagcaatacctataatattttggtgtat
ggcccctggagccacggtgactgggctcgggaaagcgggaggcagtctgttggcaatgtg
tattttggggatagcctttctacaagatttcaacaggattacgaaacaaagttctttaac
catttcttaaaacaaaacggtaaaggctccttagacttggctgaggcacatatttatgat
actggtaaaagggaatggacagattatgggcagtggcctccaaaaaacaccgtaacaaaa
actttttatttaggggatgatcaggaacttacaacccagcccacagatacaaaacaagag
tttgtaagtgaccctgcaaaaccggtatcgtataacgatgaaatcaagacggtatttacg
ccacgggaatacatgaccggcgaccagcggtttgcagcaagaagaccggatgtactggtg
tatgaaaccgaagttttagacgaagatctaagtgtggttggagaaattgaagcaatgcta
aaagttgcaactacgggaagcgccgcagattgggtagtcaaagtgatcgatgtataccct
ccagatgccgagaactatcctgaaacgatggatcatttaaagatgagcaattatcacatg
atggttcgtagtgaagtgatgcggggccgttttagaaatgatttctcaaaaccagagccg
tttgagcctaacaaaaagactgatgtaaatattacattacaaggggtaaaccataccttt
aaaaagggccataagatgcaaatccagattcaaagtacctggtttcctttaatcgatctt
aacccacaaatttatgtagacaacatttttaaagctgaaaaagacgattttcagaaacaa
acacataccgtatttggagattctgccattaaattttcggtactgaaaaaataa

DBGET integrated database retrieval system