KEGG   Zunongwangia profunda: ZPR_2843Help
Entry
ZPR_2843          CDS       T01216                                 

Definition
(GenBank) aldose 1-epimerase
Organism
zpr  Zunongwangia profunda
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ADF53163
UniProt: D5BG50
Position
3067919..3068791
Genome map
AA seq 290 aa AA seqDB search
MYILKNDHLQIGIQHNGAELCSIKNMQNNKEYMWQADSEIWGSHAPNLFPVIGALKGGKI
KYEGQYYDMPRHGFIRHNENLEVKDQTETSITFSIKSNEELRKIYPFEFEFNLCFTLKDK
SIQVNHLVKNLDAKPIYFQIGGHPAFNAPLFDGEKYEDYYLEFDQNLNLETFLLGESGLV
SENTKMVIENSDKIQLTKDLFNNDALIFKNIVSKHVSLKSKKHGSILSVSYKDFKNLGIW
AKPGAPYVCIEPWLGIADVESTDQNFKTKEGIIALEKEKEYSATYTITIE
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgtatatactcaaaaacgatcacttacaaatcgggattcaacataatggagccgaatta
tgtagtattaaaaacatgcaaaacaataaagaatacatgtggcaggctgactctgaaatt
tggggcagccatgctccaaacttattccctgttatcggagccttaaaaggcggaaagatc
aaatatgaagggcaatattacgatatgcccagacatgggtttattaggcataacgaaaat
ctagaagtgaaagatcaaacggaaacctcaattaccttcagcataaaaagcaatgaggag
ttacgtaaaatctatccttttgagtttgaatttaatctttgtttcactttaaaagacaaa
tcgatacaagtgaatcatctggttaaaaatctggatgcgaaacctatttattttcagatt
ggcgggcatccggcatttaatgcaccgctttttgatggagagaaatatgaagattactat
ttggaattcgatcaaaacctgaatttagaaacttttcttttaggagaaagcggactggta
agcgagaatactaaaatggtgattgaaaacagtgataaaattcagcttaccaaagacctt
tttaataatgatgctttaatttttaaaaatattgtttcaaaacacgttagcttaaaaagt
aaaaaacatggatctattttaagtgtttcgtacaaggattttaaaaaccttggcatttgg
gccaagcccggtgcaccttatgtttgcattgaaccatggttggggattgcagatgtagaa
agcaccgatcaaaactttaaaaccaaagaaggtattattgctttagaaaaagaaaaagag
tatagcgcaacttatactataactatcgaatag

DBGET integrated database retrieval system