KEGG   Zunongwangia profunda: ZPR_2846Help
Entry
ZPR_2846          CDS       T01216                                 

Definition
(GenBank) two-component system sensor histidine kinase
Organism
zpr  Zunongwangia profunda
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_kinase
Motif
Other DBs
NCBI-ProteinID: ADF53166
UniProt: D5BG53
Position
complement(3070484..3071464)
Genome map
AA seq 326 aa AA seqDB search
MFFFAIEDSDLWLSAQFSLALMPVTIGTTYTFSYTLMPNYLYRRKYFLFGLYSFYALVIS
ASLIIFSAFYGYLLSVGLEWEGSYPVSKGLTFIFFAVYLVIAFGCSLSLTKSYFKTLNKN
EELKNTLLENELQLKIQELQYLKMQIHPHFLFNTLNTIYGLALTKKDSAPGMILKLADLL
DYILYETNKNKVPLHREIQHLKDYIELENLRFGNRLIAEISIADFSTDIEIPPMLFLPFL
ENSFKHGKSAEGILNIKWKLEIIEDQLLFLLKNSVPARKEILDQNSGIGLENIQKRLKYI
YGEAYGLEVITTKKSYSVLLKIPINF
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgttcttttttgcgatagaggattcagatttgtggttatctgcacaattttctcttgcg
ttaatgccggtaactatcggcactacctatactttttcgtatactttaatgcctaattac
ctttacaggagaaaatattttttatttggtctttattcattttatgctcttgttatttcg
gcttcattaatcattttttcagcattttatggctatctacttagtgtaggcttggagtgg
gagggaagttaccctgtttctaaaggattaacctttatattttttgcggtgtatttggtc
attgcttttggctgtagtttaagcctaaccaaatcttattttaaaaccttgaacaaaaat
gaagaattaaaaaatactttattagagaatgaattacagcttaaaattcaggaattacag
tatttaaaaatgcaaattcatcctcatttcctattcaataccctaaatacgatttatggt
ttggcgctcaccaaaaaagattcggcaccgggaatgatcttaaaactggccgatttactg
gattatattttatatgaaaccaataaaaataaggtgccattacatcgagagatacaacac
ctaaaagactatattgagttagagaatcttcgttttggtaaccggttaattgctgaaata
agtattgctgatttttcaactgatattgaaattccacctatgctttttctaccattcctg
gaaaattcatttaaacatggaaaatctgctgaaggaattctgaatataaaatggaagctc
gaaattatcgaagatcaattgctatttttactgaagaattcggtaccagcacgcaaggaa
attttagaccaaaattctggaattggtcttgaaaatatccaaaaacgcctaaagtatatt
tatggagaggcgtatggtttagaagttatcacaacaaaaaagtcttactcagttttacta
aaaattcctatcaatttttag

DBGET integrated database retrieval system