KEGG   Zunongwangia profunda: ZPR_2848Help
Entry
ZPR_2848          CDS       T01216                                 

Definition
(GenBank) two-component response regulator
Organism
zpr  Zunongwangia profunda
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg LytTR PriCT_1
Motif
Other DBs
NCBI-ProteinID: ADF53168
UniProt: D5BG55
Position
3072206..3072916
Genome map
AA seq 236 aa AA seqDB search
MPAPINCILVDDEPVALDIMENHLSKIEGIHVLERCSNATEAFNIISKENVHLIFLDINM
PGISGISFAKSINKNLQIIFVTAYREYAIDGFDLHATDYLLKPVSFDRLLDAINNYRKNH
SEKEITKIAEKEAEFIFVKIDRQMVKIDFKELLYIESYADYLKIHLLTDTKITRETISAI
EEKLPKSKFLRTHRSFIVSITKIESYTNEQVVLRQKSIPISRSFKEQVLEKLAEFH
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcacccattaattgtattcttgtagatgatgagcccgttgcgctggatattatg
gaaaatcatctttctaaaattgaaggcattcatgtcttagaaagatgtagcaatgcaact
gaagcatttaatataattagtaaagaaaatgttcaccttatctttttggatatcaacatg
ccgggaatttcagggatttcttttgcgaaatcgatcaataagaaccttcagattatattc
gtcaccgcttaccgggaatatgctatagatggttttgatttgcatgcaaccgactattta
ttaaaacctgtttcttttgatcgtttgttagatgcgattaataattaccggaaaaatcat
tcagaaaaggaaattaccaaaatcgctgaaaaggaagcggaatttatttttgtaaaaata
gatcgtcaaatggtgaaaatcgactttaaggagttgctttatatcgagagttatgctgat
tatttaaaaatccatctactcactgatacgaagatcaccagagaaaccattagtgctatt
gaagagaaattaccaaaatctaaatttctaagaacacatagatcgtttatcgtttcgatc
actaaaattgaatcgtatacgaatgaacaggtagtactaagacaaaaatcgatccccata
agccgaagttttaaagaacaggtcctggaaaaattagctgaatttcattaa

DBGET integrated database retrieval system