KEGG   Zunongwangia profunda: ZPR_2850Help
Entry
ZPR_2850          CDS       T01216                                 

Definition
(GenBank) Hep_Hag family protein
Organism
zpr  Zunongwangia profunda
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YadA_head dbPDZ_assoc
Motif
Other DBs
NCBI-ProteinID: ADF53170
UniProt: D5BG57
Position
complement(3074465..3075781)
Genome map
AA seq 438 aa AA seqDB search
MKIITPNRVFSALFFILINFTSGIAQVGIGTDSPDASSILDIKSKNAGLLIPRLELKGIN
YSTPVSKPANGLLVYNINTQNDVTPGFYFWANDKWNRISETVNAWNTSGNKNTTDDNFLG
TTDSRPLNFRVADNKIASFGTSNNISFGLNATAANRNAIAIGDQANAATSNSIAFGYVSN
STGDNAVSIGWDAIASGKDAYAIGRSSRSENSNTVAIGRDANANGANGISLGVGAKSSGS
NATAIGYQANATQDNSIILGNSSSSSNRVGIGTNTPNQTSILDVNSTSKGALIPRMTAAQ
RTAITNPATGLLVYDTTRKCLSQQVGTPSSPDWVCISGNVVRFFYLPSLNIDTSTKGTGR
TVNLYQSYKDQFSSPVVSSPGASGIPYFKSASDLEYYVTAYDTSVLSNLSINSNGVLTYD
VIGSATPCSFINVVLVVK
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataattacacctaatagggtcttttctgccctatttttcattttaatcaatttt
acttccggtattgcccaggtgggtataggaacagattctccagatgcctcttctatttta
gatataaagagtaaaaatgcaggattattaattcctcgtctagaattaaaaggaataaat
tatagtactccggtatcgaaacctgcaaatggattgcttgtttacaatataaacacgcag
aatgatgtaaccccgggattttatttctgggcaaacgataaatggaatcggatttcagaa
acagtaaatgcctggaatacgagtggtaacaagaacacgacagacgataactttttgggt
actacagatagcagacctctaaattttagagtggcagataataaaattgcctcttttgga
accagcaataacataagttttggattgaatgctactgcagcaaaccgtaatgctattgct
attggagatcaagccaatgcggcgacttcaaatagtattgcatttggatatgtctcgaat
tcaacgggagataacgcagtttccataggatgggatgccatcgcttcagggaaggatgct
tatgcaataggtcgtagttctcgttctgaaaattcgaatactgtagctattggccgcgat
gctaatgcaaatggcgctaacgggatatctttaggagtaggagcaaagagcagcgggagt
aatgctacagccattggttatcaggctaatgctacccaggataactcaataattttaggc
aattctagtagttcatcaaatagagtgggaattggtaccaatacgccaaatcaaacttcg
atattagatgtgaacagtacgtctaagggagctttgattccccggatgactgctgcacaa
agaacagcaattacaaaccctgctactggtttattggtttacgatactacgagaaaatgc
ctaagtcaacaagtaggaacaccatcttctccagattgggtttgtatttctggaaacgtt
gtgcggttcttttatttaccaagtttaaatattgatacttctactaaaggtaccggaaga
acggtaaacctttaccaatcttataaagatcaattttcttctccagtagtatcaagcccg
ggggcttcaggaattccttattttaaatctgcttcagatttggagtattatgtaaccgcc
tatgatacttcagttttatcgaatctttccatcaatagtaatggtgttcttacctatgat
gtgataggtagtgctaccccctgttcttttataaacgtagtgttagttgtaaaataa

DBGET integrated database retrieval system