KEGG   Zunongwangia profunda: ZPR_2853Help
Entry
ZPR_2853          CDS       T01216                                 

Definition
(GenBank) Na+/H+ antiporter
  KO
K03315  Na+:H+ antiporter, NhaC family
Organism
zpr  Zunongwangia profunda
Brite
KEGG Orthology (KO) [BR:zpr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:zpr02000]
    ZPR_2853
Transporters [BR:zpr02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   ZPR_2853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_H_antiporter DcuC
Motif
Other DBs
NCBI-ProteinID: ADF53173
UniProt: D5BG60
Position
3077700..3079184
Genome map
AA seq 494 aa AA seqDB search
MENHTPHAEENVTKKELSIWAALIPVFALIIMLGFNVLVVYGDEALSGSNQFILLLGGAV
AAIVGYFNKVKFDSMIDEVAKNIQSTAGAILILLMVGALAGTWLISGIIPTMIYYGLQIL
NPTIFLAATVIICSVISVATGSSWTTSATVGIALVGIADALGIPLGMTAGAILSGAYFGD
KMSPLSDTTNLAPAMAGTDLFTHIRYMAITTVPTIVVTLIIFVIIGLNLDTTGSTDTSAI
LNAIDASFNITPWLFVVPALVIFLIVRKTSPLIALLVGTLLGAVAALIFQPNIVLEISGS
DELTFVSAYRGIMDAITVDTAIETQSAALNDLFASSGMAGMLGTIWLIICAMVFGGIMDA
IGALARISKALLNLFDSVFGLFASTVISCLALNVTASDQYLAIVVPGKMFAKAYKDKGLA
PENLSRTLEDSGTVTSVLIPWNTCGAYHSGVLGVPVLSYVGYCFFNYLSPFMTLLFAAFR
IKIKELGSPETRTA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaccatactccccacgctgaagaaaacgtcaccaaaaaagagctaagtatttgg
gctgcattaatacccgtatttgcgcttatcatcatgcttggatttaatgttctcgtggta
tatggagatgaggctttaagtggttctaatcaatttattttgcttttggggggcgctgta
gcggcgattgtagggtactttaataaggtaaagtttgatagcatgatcgacgaagtagct
aaaaacatccaaagtacggcaggagcaattttaatcttattaatggttggggctttagca
ggtacctggcttatcagcggaattattccgactatgatttactacgggttgcaaattcta
aatcctactatattccttgctgctacggtaattatctgttctgtgatttctgtagctaca
ggcagtagctggaccacttcagcaaccgtaggtattgctcttgtaggaattgctgatgct
ctgggtattccgttaggaatgacggccggtgccattctctccggagcttattttggtgat
aaaatgtctccattgagtgataccaccaatcttgcacctgcgatggcaggaacagatctt
tttactcatattagatatatggcaattaccactgtaccgacaatcgttgtcacattgatc
atctttgtgattattggtcttaatttagataccactggttctacagatacttccgccatt
ttaaatgccatagatgcatcattcaatatcacaccatggttgtttgtagtgcctgccctg
gtaatttttctaattgttagaaaaacctcaccattaatcgctttattagttggcactctt
ttaggagctgtagccgctttaatttttcaaccaaacatcgtactcgaaattagcggaagc
gatgaacttacctttgttagcgcttaccgcggaattatggatgccataacagtagacact
gctatagaaacacagtctgccgctttaaacgatctttttgcttctagcggaatggcagga
atgctgggaactatctggttaattatatgtgctatggtttttggcgggatcatggatgcc
attggggctttagccagaataagcaaagcactgctaaacctctttgatagtgtatttgga
ctttttgccagtacagtgataagctgtcttgctcttaacgttacagcatcagaccaatac
ctggccatagtggttcccggaaaaatgtttgccaaagcctataaagataagggccttgct
ccagaaaacctgagtagaaccttagaagattcaggtacggttacttcagtactcatccca
tggaatacttgtggtgcttatcatagcggagtgctgggcgttccggtactttcttatgtt
ggctattgctttttcaattatttgagtccgtttatgactttattatttgctgctttccga
ataaaaattaaggaactggggtctcccgagacacgtaccgcatag

DBGET integrated database retrieval system