KEGG   Zunongwangia profunda: ZPR_2857Help
Entry
ZPR_2857          CDS       T01216                                 

Definition
(GenBank) thiol peroxidase
  KO
K11065  thiol peroxidase, atypical 2-Cys peroxiredoxin [EC:1.11.1.15]
Organism
zpr  Zunongwangia profunda
Brite
KEGG Orthology (KO) [BR:zpr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ZPR_2857
Enzymes [BR:zpr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.15  peroxiredoxin
     ZPR_2857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Redoxin AhpC-TSA SCO1-SenC
Motif
Other DBs
NCBI-ProteinID: ADF53177
UniProt: D5BG64
Position
3080779..3081279
Genome map
AA seq 166 aa AA seqDB search
MSEISFKGERVITYGDLPAIGEKAPHFDLIKTDLSKAKLEDFKGKRVILNIFPSIDTGVC
ATSVRNFNERATELDNTVVLCISRDLPFAQKRFVNDEGLKNVINLSDFKEREFGKDYGVE
MITGPLEGLLSRVVIVLDENLNVIHTQQVPDIAEEPNYLAALKTLL
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaatatcgtttaaaggcgaaagagtgattacttacggagatctgcctgcgatt
ggtgaaaaagcaccacattttgatcttataaaaaccgacctgtctaaagccaaactagaa
gattttaaaggaaaaagagttatccttaatattttcccgagtattgataccggagtttgt
gcaacatccgtacgaaattttaacgagagggctaccgaattagataatacggtagtactt
tgcatctcgagagatttaccattcgcacaaaaaaggttcgtaaatgatgaaggtttaaaa
aatgttattaacttgtctgactttaaagaacgtgagtttgggaaagactacggtgttgaa
atgatcaccggtccccttgaaggtttactttcacgggtagtaatcgttctggatgaaaat
ttaaatgttatccatactcagcaagtgccggatatcgctgaagaaccaaattatcttgct
gcgttaaaaacgcttttataa

DBGET integrated database retrieval system