KEGG   Zunongwangia profunda: ZPR_2859Help
Entry
ZPR_2859          CDS       T01216                                 

Definition
(GenBank) hypothetical protein
Organism
zpr  Zunongwangia profunda
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADF53179
UniProt: D5BG66
Position
complement(3081771..3081902)
Genome map
AA seq 43 aa AA seqDB search
MVFRNFRQKYKLAPSKIKKIKFNFKTGLFLRKTLKRRLYFPDS
NT seq 132 nt NT seq  +upstreamnt  +downstreamnt
gtggtttttcggaattttcggcaaaaatacaaattagccccttctaaaataaagaaaata
aaattcaattttaaaacgggtctttttttaagaaaaacgctgaaaaggaggctttatttt
cccgatagttaa

DBGET integrated database retrieval system