KEGG   Zunongwangia profunda: ZPR_2863Help
Entry
ZPR_2863          CDS       T01216                                 

Definition
(GenBank) permease
  KO
K07091  lipopolysaccharide export system permease protein
Organism
zpr  Zunongwangia profunda
Pathway
zpr02010  ABC transporters
Module
zpr_M00320  Lipopolysaccharide export system
Brite
KEGG Orthology (KO) [BR:zpr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ZPR_2863
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:zpr02000]
    ZPR_2863
Transporters [BR:zpr02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter [MD:M00320]
    ZPR_2863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YjgP_YjgQ
Motif
Other DBs
NCBI-ProteinID: ADF53183
UniProt: D5BG70
Position
3085212..3086435
Genome map
AA seq 407 aa AA seqDB search
MVFGSFAENYEFAAMKSSGISLQRAMRGLTLFIVLVSITAFVFANNVIPAAEFKIINLRK
NIAKMKPAMAITAGVFNEVGNINIKVDKKSGDNDQYLHDVIIHTGTERGGDYTVIKSKEG
ELVSSEGSNVLSLVLTDGNYYREVQPSDYSKRDHKPFMKSYFEEYTKNIDLSELNQVDMD
DESYTTQSMLRIGELTKSIDSFSVSLNERKEAFATSMYSRTGVKSLDINFNPEESDKYKS
FKHSILDNYNSNQSQRIVDDAIRTTNAAISHLSIKKQEFKQSSRRLNKYEIALHEKYVLA
VACIVLFFVGAPLGAIIRKGGMGLPMVIAIIIFLSYHFIGIFAKNSAEDGSISPFIATWL
STLIMLPLGIYFTYRATTDQGLFSFDIITEPISKFFKKIGLVKPKDK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggtttttggtagttttgccgaaaattacgagtttgccgccatgaaatcttcggggatt
tctttacagcgcgcaatgcgcggtcttactctttttattgtactggtaagtattaccgcc
tttgtttttgctaataatgtgattcccgccgctgagttcaaaattattaacctgcgaaaa
aacattgctaaaatgaaaccggcaatggccattaccgcaggtgtttttaacgaagttgga
aatatcaatattaaagttgacaaaaagagcggggataacgatcaatacctccacgatgta
atcattcataccggaactgaacgtggtggtgattatactgtaatcaaatccaaagaagga
gaattagtaagtagcgaaggttctaacgtattgtctttagttctaaccgatggaaattac
taccgagaagtacaacccagtgactattctaaacgagatcataaaccttttatgaaaagt
tattttgaggagtacactaaaaatatcgacctctccgaattaaaccaggtagacatggac
gatgagagttatacgacacaaagtatgcttagaattggtgaacttaccaaaagtatagat
agcttttcggtttccttaaacgagcgtaaagaagcttttgcaacttctatgtatagtaga
accggagttaagtctttagatattaatttcaatccggaagaatctgataagtataaaagc
tttaaacattctatattagataactacaacagcaatcagtcacaacgcattgtagatgat
gcgattagaactaccaatgctgcaatttctcacctttctataaaaaaacaggaatttaag
caaagtagtagacgcttaaataaatatgaaattgccctacacgaaaaatatgtacttgcg
gtagcctgtattgtactcttttttgttggagctcccttaggcgccattatccgtaagggg
ggcatgggactcccaatggttattgcaattatcatttttcttagttatcattttataggg
atttttgctaaaaacagtgcagaggatggcagtattagtccgtttatagctacatggctt
agtaccctaattatgctaccgttggggatttattttacctatagggctactacagaccag
ggattattttcttttgatataataacagaaccgatctcgaaattctttaaaaagatagga
ctggtaaagcccaaagataaatag

DBGET integrated database retrieval system