KEGG   Zunongwangia profunda: ZPR_2864Help
Entry
ZPR_2864          CDS       T01216                                 

Definition
(GenBank) bifunctional protein: GTP cyclohydrolase II; 3,4 dihydroxy-2-butanone-4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
zpr  Zunongwangia profunda
Pathway
zpr00740  Riboflavin metabolism
zpr00790  Folate biosynthesis
zpr01100  Metabolic pathways
zpr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zpr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    ZPR_2864
   00790 Folate biosynthesis
    ZPR_2864
Enzymes [BR:zpr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     ZPR_2864
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     ZPR_2864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2 EF-hand_8
Motif
Other DBs
NCBI-ProteinID: ADF53184
UniProt: D5BG71
Position
3086471..3087619
Genome map
AA seq 382 aa AA seqDB search
MSGINEGHKSFKLNTIKEAIEDIKAGKVVIVVDDEDRENEGDFVAAAEKVTPQMINFMAT
HGRGLICAPITEDRSKELGLNLMVDDNTVLHNTQFTVSVDLIGHGCTTGISTHDRAKTIK
ALTEKETKPEDLGRPGHIFPLRAKNGGVLRRTGHTEASIDLARLAGLQSAGILVEILNED
GSMARLPQLMEVAKKFNLKIISIEDLVAYRMQHDSLIVKEEDFDIKTRFGEFRLRAFKQT
TNNQIHIALTKGAWTKEEEVLVRMNSTLVNNDILDTLMNDADKKLDSMFKALDKDGKGAV
VFINPATKPLSLLSRLAELKENQKEGTLKAPQPSMDNKDFGIGAQILHDLGIHKIKLLSN
SKQTKRVGMIGYGLEIVDYVNY
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaattaatgagggacataaatcctttaagttaaatacaattaaagaggctatt
gaagatatcaaagctggtaaagtagttattgtagtagatgatgaagatcgcgaaaatgaa
ggtgattttgttgctgctgctgaaaaagtaactccacagatgattaactttatggctact
cacggccgcggattaatatgtgccccgattaccgaggatcgatctaaagaattggggtta
aacctgatggtagatgataataccgttttgcataatacgcaatttacagtttctgtagat
ctaattggtcatggatgtaccacaggaatttcaacccacgatcgtgcaaaaaccataaaa
gccttaaccgaaaaagaaaccaaacctgaagatttaggaaggcctggacatatattccca
ctaagggctaaaaatggcggtgttttaagaagaacagggcatactgaggcatctatagat
cttgctcgtctggctggactgcaatcagccggaattttggtagagatcctaaatgaagat
ggtagcatggcaagacttccccaacttatggaagttgccaaaaaatttaatcttaaaatt
atttctatcgaagatctggtggcatatcgtatgcaacatgattctcttattgtaaaagaa
gaagattttgatattaagaccagattcggtgagtttagattgagggcctttaagcaaacc
accaataatcaaatccacattgcgcttactaaaggtgcgtggactaaagaagaagaagtt
ttggttcgtatgaattctactttggtcaataatgatattctagacaccttaatgaatgat
gccgataaaaaattagatagcatgtttaaggcattggataaagatggtaaaggtgctgtt
gtatttattaatcctgcaactaaaccgctaagccttttaagccgattggcagaattaaaa
gaaaatcagaaagaaggtacactaaaagcaccccaaccttctatggataataaagatttt
gggataggagcacaaatattacatgatctcggtatccataaaataaaactgctttctaat
tccaaacagacaaagcgtgtaggaatgattggttatggcctggaaatcgtagattacgta
aattactaa

DBGET integrated database retrieval system