KEGG   Zunongwangia profunda: ZPR_2869Help
Entry
ZPR_2869          CDS       T01216                                 

Definition
(GenBank) hypothetical protein
Organism
zpr  Zunongwangia profunda
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADF53190
UniProt: D5BGK9
Position
3093670..3093774
Genome map
AA seq 34 aa AA seqDB search
MTFFSIYLFRLFLNNFANVKTYNHFKKLIQIYFK
NT seq 105 nt NT seq  +upstreamnt  +downstreamnt
gtgacatttttttcgatctatttatttagactatttttaaataatttcgcaaatgtaaaa
acctacaatcattttaaaaagctaattcagatttattttaaataa

DBGET integrated database retrieval system