KEGG   Zunongwangia profunda: ZPR_2874Help
Entry
ZPR_2874          CDS       T01216                                 

Definition
(GenBank) short chain dehydrogenase
Organism
zpr  Zunongwangia profunda
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase
Motif
Other DBs
NCBI-ProteinID: ADF53194
UniProt: D5BGL3
Position
3097166..3098110
Genome map
AA seq 314 aa AA seqDB search
MNFWSLSKAKKKEGKIAIVTGANAGIGYETTKGLASVGVEVIMACRDLQKAETAKQKILK
SLPEAKLTLMEIDLASLASVRAFAKSFKSQYNKLDMLVNNAGVMMTPFQKTEDGLELQME
VNYFGHFLLTGLLIPVLEKSFRSRVVSLSSLAHRWGDIHFDNLNAEKSYDKRQFYAQSKL
ACLIFAYHLDKKLVKKGFDMHSYAAHPGISNTNLMRNLPGWLRFLSPLLMPIFSQSAEKG
ALPILRACLDDTLNGGEYIGPSGTKQYKGHPVIVDSDYNSKDKYKAKKLWKESEKIVDFE
YFKDRELKKEAQAS
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaacttttggtctctaagtaaagcaaaaaaaaaggaaggtaaaattgccattgtaacc
ggagcaaatgcaggtattggttacgaaactaccaaaggacttgccagcgtaggagttgaa
gtgattatggcctgccgtgatctacaaaaagctgaaactgccaaacaaaaaatattaaaa
tcactacctgaggctaaattaacgcttatggaaattgatcttgccagtcttgcttctgta
cgtgcttttgctaaaagttttaaatcccaatataacaaacttgatatgttggtaaataat
gccggagtaatgatgacaccttttcagaaaaccgaagatggtttagaattacaaatggaa
gtgaattattttggtcattttttacttaccggattattgattcctgttttagaaaaatct
tttagatcacgggtagttagcctaagtagtcttgcccaccgctggggagacattcatttt
gataatttaaatgctgaaaaatcctacgataagcgtcaattttatgcccaaagcaaattg
gcatgccttatttttgcttatcatctggataaaaaactggtaaaaaaaggtttcgatatg
cattcttatgcagcacatcccgggatttctaatactaacctaatgagaaacctgcccgga
tggttaagattcttatcccccttactaatgcccatattttctcaatctgctgaaaaaggt
gcgcttcctatcttacgtgcctgcttagatgataccttgaatggtggagaatatattggt
ccttcaggaaccaaacaatataaaggacatcccgtaattgtagattcagattataattct
aaggataaatataaagccaaaaagctttggaaagaatctgaaaaaatagtcgattttgaa
tattttaaagatagagaattaaaaaaagaagctcaggcctcatag

DBGET integrated database retrieval system