KEGG   Zunongwangia profunda: ZPR_2876Help
Entry
ZPR_2876          CDS       T01216                                 

Definition
(GenBank) D-3-phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
zpr  Zunongwangia profunda
Pathway
zpr00260  Glycine, serine and threonine metabolism
zpr00680  Methane metabolism
zpr01100  Metabolic pathways
zpr01120  Microbial metabolism in diverse environments
zpr01130  Biosynthesis of antibiotics
zpr01200  Carbon metabolism
zpr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:zpr00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    ZPR_2876
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ZPR_2876
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:zpr04147]
    ZPR_2876
Enzymes [BR:zpr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     ZPR_2876
    1.1.1.399  2-oxoglutarate reductase
     ZPR_2876
Exosome [BR:zpr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ZPR_2876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh HAD NAD_binding_2 AdoHcyase_NAD ACT DpaA_N DUF724 XdhC_C
Motif
Other DBs
NCBI-ProteinID: ADF53196
UniProt: D5BGL5
Position
complement(3100233..3102125)
Genome map
AA seq 630 aa AA seqDB search
METKRNYVIDFDSTFTQVEALDVLGEISLANAKDKEAKLAELKSLTDRGMEGKLAFRDSL
RERLDILEAEEKHLEPLIENLKTRISKSFRRNEEFFRENRDHIYIMSNGFKEFIIPIVAE
LGIKAEHVFANDFVFDENRKIVGFNTENVLSSNNGKVKQLQSLDLQGDVYVIGDGYTDYE
IKAAGLANKFYAFTENVERDQVTEKADHITPSFDEFLYLHKMNKAISYPKNRIKVLLLEN
VHADAVKIMKEEGYNVQTIAGALDEEELSEQIKDVHVLGIRSKTQLTKKVLENANRLMAV
GAFCIGTNQIDLEACLDKGVAVFNAPYSNTRSVVELAIGEIIFLMRNLPDRIAEMHQGIW
NKSATGSFEVRGKKLGIVGYGNIGAQLSVMAESIGFDVYYYDLVERLALGNATKCSSLDE
LLQTVDIVTFHVDGRKENKNIIGDRELSLMKEGSYLLNLSRGSVIDIEALHKHISSGRIK
GAGVDVFPKEPKTNQEEFVSKLKGLPNVILTPHIGGSTEEAQENIGNFVPGKIIEYINTG
GTTNSVNFPNLQLPRLENAHRLIHIHHNKPGIIAHMNRILAANDINVVGQHLKTNETIGY
VITDINKKYDNDVIKELKGIEGTIRFRVLY
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaaaggaattacgtaattgatttcgatagtacttttacccaggtagaagct
ttagatgtgttgggagagatatcccttgcaaatgcaaaagataaagaggcaaaattagcc
gaacttaaatcccttaccgaccgcggtatggaaggtaaactagcttttagggattcgctt
agggaacgccttgatattttggaagccgaagaaaaacatcttgaacctcttatagaaaat
cttaaaacacgtatttctaaatcctttagacgtaacgaagagttctttagagaaaaccgc
gaccatatttatatcatgtcgaatggctttaaagaatttataattcccattgttgctgaa
ttgggtattaaagcagaacatgtttttgcgaatgattttgtatttgatgaaaatcgtaaa
attgtaggctttaatactgaaaatgtacttagcagcaataatggtaaagtaaaacaatta
caatcactggatctacaaggcgatgtttatgtgataggtgacggctataccgattatgaa
attaaggcagccggccttgctaataaattttatgcctttaccgaaaatgtggagcgggat
caggttactgaaaaagccgatcatatcactccaagtttcgatgaatttttatatctacat
aaaatgaataaagcgatttcgtatccaaaaaaccgaattaaagttttacttcttgaaaat
gttcatgcagatgctgtaaaaatcatgaaagaagaaggctataatgttcaaacgatagct
ggtgctttggacgaagaagaattaagcgaacaaataaaagatgttcatgttttaggtatt
cgttctaaaacgcaattaaccaaaaaagtattagaaaacgccaatcgattaatggctgtg
ggcgctttttgtattggtaccaatcaaatcgatctcgaagcctgtcttgataaaggagta
gcggtatttaatgcaccttatagtaatacccgatctgtagtagagttggctattggagaa
attattttcttgatgcgcaatttaccagatcgtattgctgagatgcaccaggggatctgg
aataaatcggctacgggaagttttgaggtaaggggaaagaaactgggaattgtaggttat
ggcaatataggagcacagctttctgtcatggcagagagtataggctttgatgtatattac
tacgatcttgtagagcgtttagctttaggaaacgctacaaaatgcagttctttagatgaa
ttattgcaaactgtggatatcgtcacctttcatgtagacggcagaaaggaaaacaaaaat
attataggagatcgcgaactttcattaatgaaagaaggttcttatttattgaatcttagc
cgcggatctgtaatcgatattgaagccttgcataaacatatttcttctggaagaataaaa
ggggcaggggtagatgtatttcctaaagaaccaaaaaccaatcaggaagaatttgtttct
aaattaaaaggtctaccaaacgtaattcttacaccgcatattggcggaagtactgaagaa
gcccaggagaatatcggaaattttgtacccggtaagattatagaatatataaatacggga
ggaactacaaatagtgtaaacttccctaatttacaattgcctagattagaaaatgcacac
cgcttaattcatattcatcataataaacccggtattattgcccatatgaacagaattttg
gcggcaaacgatatcaatgtggttggtcaacatcttaaaaccaacgaaaccattggttat
gtgatcaccgatattaataaaaaatatgataacgatgtgatcaaagaattaaaaggaata
gaagggacaatacgttttagagttctttactag

DBGET integrated database retrieval system