KEGG   Zunongwangia profunda: ZPR_2880Help
Entry
ZPR_2880          CDS       T01216                                 

Definition
(GenBank) hemolysin-3 family protein
  KO
K11068  hemolysin III
Organism
zpr  Zunongwangia profunda
Brite
KEGG Orthology (KO) [BR:zpr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:zpr02042]
    ZPR_2880
Bacterial toxins [BR:zpr02042]
 Type II toxins: Membrane damaging toxins
  Pore-forming toxins, Other
   ZPR_2880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyIII
Motif
Other DBs
NCBI-ProteinID: ADF53200
UniProt: D5BGL9
Position
complement(3108259..3108915)
Genome map
AA seq 218 aa AA seqDB search
MRDRDRIKYYTKSEERLNVISHAIGLFLSVIGLILLIVKAGQLSLMALKVSYWIFGSSII
LLYAASTLYHSVRERKLRYRLNILDHASIYILIAGTYTPFSLVTLQGSVGWIIFGVVWAL
AIIGVILKLFFTGRFETLSTIMYVAMGWIIVFAVKPLIDNLSQDGLIWLFTGGISYTIGA
VIFSIDRLKYNHAIFHVFVLFGTFCHFLAIYYYVIPNE
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgagagatcgcgataggataaaatattataccaaatctgaagaacgtcttaatgtgatc
tcacatgcaataggcttattcttaagtgtaattggcttaatactactaattgtcaaagcg
ggtcagttaagccttatggcgctaaaagtaagttactggatttttggtagcagtattatc
cttctttatgcagcctctacactttatcatagcgtaagggagcgtaaattgcggtaccga
ttaaatattctggatcatgcctcaatttatattcttatcgctggtacgtatactccgttt
tctctggttaccttacagggaagcgtaggctggataatattcggtgttgtttgggcttta
gcgattataggtgtgattttaaaattgttttttaccggcaggtttgaaaccttaagtact
atcatgtacgtggcaatgggatggattattgtttttgcagtaaaaccattgattgataat
ttatctcaagacggcttaatatggctttttaccggcggaatttcttataccataggagcg
gttatttttagtattgacaggctaaaatacaaccatgccatttttcatgtatttgtatta
tttggtactttttgccattttctggccatctattattatgtaatccccaatgaataa

DBGET integrated database retrieval system